Uttar Pradesh act 12 of 2019 : The UTTAR PFtADESH PRIVATE UNIVERSITIES ACT, 2019

Department
  • Department of Higher Education

<-ICQII-151 (-2) '<1imi -Pi —kreoTeatito /Rao

5.sciptcro410-91/2014-16

are:19i

tifetta 177 Uff? ribT zwz 04114 taw( ITU TM-TOM

3111TEIRT Ell 4 ibC

Tfri-1, (.4'14 (W)

(.11-ft rrksT arfirftaff)

41 6 Mtd, 2019 _

41Mut 15, 1941 img

\TO( wavr

ft-Trzft arlffm-1

11tsgi 1451/79-R-1-19-1M11-19

emith, 6 311T1, 2019

aiRRFT real%

"Tuff T•tifdEn-r" aira 200 alt tivtimictf 96t(41 31T Sib' fdl RYcirdqiciti

Ng% 2019 f3fti 3T %tn. aT1FT-1 ImitAct) t tiksAid L ct Riich

5 allreT, 2019 t GT-1.91% ST4T9 3117 ‘ickit CRT ,iiNi;e44 tits...if 12 Tff 2019 WI 4

ticitumi(ut tt ii T aifir(ffffr WU WIttff ftzrr

.ack-p< waT PhsITfacAvievi 311irePi9, 2019

(\iccV IE 31fit1lk<1l1 tit.901 12 9 2019)

‘iccH At3T MUM &rise{ gran Pi 311414TM 349' \sccvt wa-sT flyer t ‘tur-1 9wii mcirr ctr( tg 74

Thul 14zaDviet41S WTh19T t*1 3117 11wiii VidIlfdvafatim41- &t q.i14cr

cm4 war ‘i4 ctreil Thl" cdNMcr gra 30 \ilia iTRIF4Tff ZIT 31-1115ftl

ufuen cin4* f4

i Nivel iTM-4m.lPa1Cf3are4IPT row41 vit

1-0) zig 31Rffk511 \it-yr{ WkT itAt fawatheio, 3TRrffitri1, 2019 06i

flIM-T MWER ‘ick-ff At41 •ou4 it diiiii

TW ttr 124-4j— Th-sr 'cir 6)41( ‘Aiii mr4 titnnhf mild 4 3TRIWET

9N1 Thqcf Th-k I

'sit ii

dirrei 917. fatcul aM

191 RPH

image0.tif

Hdll [61 mm mm 12¢; GLOZ W'W 1&3 mm M W 9.11 (L)—L agmmmgamwwgmgwgmmm < W WfiWNMF—Q‘JM @Ewmwmgmmmm$w&_ ‘meéuwhmaaemmmmwwl (GLOZEAZLWWMM 6‘03 'WWWMH gh&%6mzkaumwmfimawwmwfimgsm‘ms mm‘gwgmwr-flmmmemz‘m memgmmmgoozzgfim$ummwm,, A BER! aLoz Lune 9 mime 6L-LL(52)L-6L—L-g;-6L/tsu um: . L—lLlhEle ml mu: man my; lam: m mu '9; mm: A aw: 1mm»: 9 mum-11¢ mum-1 (W man ma) (9!) m 't—mu. WW _ wmmmsgnm 9L—vLoz/ Le—oglohh/o‘iga om/owofiom—me " ' - ‘ (z—a) LSL—mhyz r

2 • ckV 'Cita 31311z11VI 1 I ,ld, 6 317-49, 2019

2-74c1cP 3:1- '4 31/2 3TRTT 361/2146. 9 er, Tfr 3T1Tikall ti•—

(m) 14114RtIc ml 'iffecRI faiflinevitr e flinnPne, t t;

(u) "artrF ITF-43 uer)-114 far TrItyc (- 7031rotrOtr40) ml

3r-ozrzi attra- #T-{drzr der-TA %LT Trftr; zare4qTr, 1987

am-fr3 wrIt3 3TtIFITRePT der-1(14 ftar nRnq t t;

(Tr) "44" ml MKZI. %cifatlicitf tichia N1.4 aN f*ilvirr 6414 zrr

ittt arR:r t;

(Er) "linker-74 aftztrfir- atIttTr9- TrftErc (tio7to3Trta31R0) ml

3-r- 4 linker t afittrlir-w ar-dtzTrff TritEr4, f1I t t

*NON. * lcb f414 noierni arRrwiTrr t ;

(3) tl-IPT" WI UrecRt it311/2 31t21379. ftiTrn- t t intr14 artzrzm at)7

3T-gfr-Tr9 irq t;

tkaier" wr 3T-jr4 ThR Il, c rr fliiiew T ;R119 ZIT

wiTet ar-Tettetd- flf ervi em4 1A-Ther

vLreo t t;

(as) fa-am 0 silake$1- ml cnwd c•-q W

74 iileilfle61 itTrir t t;

(7) w4-1. # Rzeria.wew W arEzrzr9- 3-R-Tr alarm- 437 er tuReirq

t;

etneinRus ml 3r314 -%aflinevr S ern4 TrNwc tit;

tierni mlur3r4 -%eiflinew tierni t t;

(z) "util kwrzr" Tr .rno:rzi 1W-1 Act) ThwrzT gkr if&-r

(3) villentr Tr urerzi fc1IEJlcl4 h arif4zir/vi T

1.91-)nenii t t;

(g) riwl Ttit zr--Ottn- Tritic (antotRoarRo) ml 3r3r4

ITR-dta 3T-Ittim Trftrc t t;

(3) "t-o_tr9- /me4 ml 3Tc'4 3TR1kac3 7t1T Erfarrti T

ar-IRTR fderflinevi wifita- est tr-mr9- zrr tclrf t; (uo "ITrar 9i4>etir nPas (trialt031Tt0) ml iffecli 9ffetz1

1-Svi11 1011; 1956 9.16-ff 1-1T3tiT Wa>cfir ITRISfq

tf t; (ff) narFS Rxardview wr uwrzl \law W

tulitw araTar Trrzrrzfr aTS akr -{P-Trferu f4-4r

lq1 ici4 t t; (er) '`uttzr tcrelier-r 74 P--Trzr# nPtiq (7ffo7o7alio) Tr 3r-ozr4

sa1410.4 rut--r 74 vmrzrff 141444 t ;

-RTEerzr ttu (krotiotto) ml 3rez4zl-ttazr ei>3e. e1,1 tr

t; (el)

1tq 3zn4 91w Trftsrc" (73ot10-er*) wr 3T-ozrzf .6t4

31UI1tI45 QM% 1-1Pq4 3Tie4-49,. 1993 5 31111/29 SM PeRT

ftraTr tritrq t t ;

19I_RPH Data 4 Vidbaika Folder (Adhiniyam_2019)

image1.tif

‘ WWWW,6M,2019 Wfimafimafi,gfimfiwfi— WW 2—mam (a?) MWmmWfiWfi‘s‘ (a) "31% W W firm may momofib’aoéo) m mmmmfimmmfimwew mmmwmfifimmm; V (11) "mimfimfiwfimmfimafisfivfimfifiafiém Wmfiéfii (2:) WW afiahfiras mafia]?! um" mowmom) an WWWWWWJ‘émfi’E‘Gfl (111) "main fififin um?" (wofitosnéo) WW,1956$W$H111%H WWW 13f %; , (a) ”We; WWW” w awn? W W'W a} W arm 3mm W11?! W W wnffia W fififi WW fir %; (a) ‘Wifiu 1mm 'qa' mm WRETWOQOQOfio) am am - W W vii W qfiq'r: fit a) ; (a) ' 3%? am“ (Gomofiro) an afimmifiu 33%? am 1? ‘5‘; ' ' (a) "W W W W" (wofioafios‘o) WW W11 WWWW..1993$WWW WWWEWE‘; - - ’191_RPHADava 4 Vidhaika Folder (Adhiniyam_20]9)

cri Tra3T 31311T-1Tar I'4 C, 6 31-93?r, 2019 3

(9) ̀Rverei to! (q9okrFokreo) miord 3rE1zr cir t t ;

(g) "FR-et-4 *it trthic (4tattotto) i ffriazi iiredter 4er-a 14Rt14 arRAzpi, 1948 met tiTT1 4 W artirff iffsd-ff lirdrzr qift treorc 31/2 t ;

(1;0 Ta-rfercrit zrr arEzreLi ufa yo-arcrf zrr uErrezier, ci3d4R1 S terq14 451 dfad -ncinc.nerzr W

w,a-ergt: zrr "31alei crvAgRi Tir ugrEzrear,

c8(1444k ";ift 'V44" t t; "ffftd." ur ffr-ozrzi tiRke-pii 5ra faro- ;

(#) "300-0 4k m<bixi4f 051 ffriazi Ro14.41d4 W arfkke 3.0 wm-rvrt t t;

(Tr) Rkqiiict) ffiwrir TT ifflezfd W-4rzr ,4-Ncw kr writa tiMcr) Awrzli t t ?Tur Rcifasnew 3r-1-4-rff

airzrrir th-frW Sifu 3TRifF In 09401 their *Eric, s-dizr rw<t)R4Rier, var their trthi, lirierzr eciff-a)pdr trfterc, 'skit irftffth M4>mi 3itt-zr ar.zrrcrw their gffirc, W-41zr lircerzr fla)c-th trthr uP_Tr

Erthrc ;

(zi) "31-130" osi wroTzi arRre4zr# t tidirr t;

(q)co) Tfr arRA-zpi 309 3P-Trierff WAT Rzlidtriertr t

Trizrfra-d niwAluico ffiwrzr" wr ii4:- (l.<r)) .4)tipia 'd- r)c.Muf 3n4ZPT, 1860 (3rf1eliTIT

titstll 21 39 1860) T 3TEIT9. •4- Octi.c1 ft3it

t t ; (t) 2TR&Zi affefri3171, 1882 (31idkEPT tItstli 2

39 1882) T 34-9. 4.**

-gig 31/2 t ; ( -f) Tillt 3TREftql3, 2013 (3T1S111 titsqf 8 39

2013) T 3T49 •?10co- mirgt

t ;

(q'.4) itiRPqfllt" 4k "arezrrtzr1" S Rf)qiiI" 11 M-0:14 0n9414 TEIM fazincriew W 509Y11 ,

"3Tarratt" 47 f1i)14f t;

faNkeriew WA mt;

(q)t.r) idxcifaview W 421T445" 451 WrOc44 3TM-711, 31Eall, tI61L14) 3TNI41 5 31-41 ar11vp4 t, 1xci11tilcier 3#4E.Tt arle# zrr Ati ttrAcr crn4 Throw 14,e.ir u114 3tt3 31UTIk`411

arezircrwl W Tizr tr-4-rftrita- faVir \3114; (<ths) w'remzrei", "fdth aiRrwrer, "gfteir

Pip-icp , eig-irwr-d-zrrEzrei" zrr cgoilerNico OYI ffrozref, Rec114rmi1 W ç Ij a1VTL ctritAcr, ug crieitAcr, qccl 3TRI514, gterrr TiTrwrwrizzrei zrr

cgoilxntio t;

1 9I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image2.tif

Wmmmmwmmzms " 3 Ff) W“??? W firm" (Wowowo) fil am "@321 W m%%; (u) "HR—cm Mafia—q” (lfiofiofio) mam? W W lufifimfim, 19483379RT4$31WWWW Wfié‘; (t5) ”Zmrrfiimma “fiWfimmfi' ”W a afi?”fifirwfi“fiffimmzfiwfimmfi 'afirrifiqffi'mwama 'ufifimfiufimmfl", "W“sfivwfirmfir“ QE‘; (:0 "ma'mmmmmmam; (l1) ”WWW mmmmfimsm Withfié; (l1) ”“fifimnfififira mWW—mwfifififlm mwfifiwfif‘afififirzfifi? 21241th Wham—c3 mmmmmm_ ' mefimwgwfimmmmafifim , m,mwmflmfimmm , Wmanqfiwq, WWWWW WWWWE‘; _ (a) "W“firmafisfiafifiwfim"amfifi"é%g (W) WWfiWWfiN—‘l’rmfi W “ama‘rTrIfififiWfiIam (V25) WWW 1860(3r1i1fi1111 W21W1860)$WWW Wfifi; (3r) WWW, 1882 (sz 1131582)?» aim—«I'm 1am waifififi Rmfié; (25h?) WW,2013(3WW8W 2013) fimfifimmfimfi fi‘a‘; ()fifififlafivmsfivfimfirmfi manila Wfifiw: NW, “31W“ cm “W“ 11 E’; , (3W) 'Wfilfimfifimfiflmfimfimwfié' f (fiat) 'fimfimmfiawmfi’w'firammmmm’f Wmmwmmfiz Rd? mammmmmmm mmfimfigfifimmsfivmfi gm 31W fi fit: FT Wfl‘fifi Ifim Gnu; (W) MW, "1W2! "fifi awfiIfiriT', “firm mafia 'W In ”'W' fir am, Wfifififififimfi,mfiawwfia_ 13a afifirfi, when filmfi ma 2:1 Wiié‘; 191_RPH_Dala 4 Vidhaika Foldar (Adhiuiyam_2019)

ftrarst mri ierrcriT fac srd

Trata 3R11z17131. TWZ, 6 NWT, 2019

(OA qYcl1av.4 Mg" TT moiti *tf 31-141k4/1 T 3T419 Tmfta

zu -1 ,11kr iWt Mi -Rxcifaview t;

(coto) Thcifawcia arla-ra &ROT" TT ffiecrd KVA

31T419 31ITMIT 3TRPTER '1956 Si tTTRT-4 T 309 -

wrieTu fct1WIici4 39419 arr t;

alfeng T 314-9. 1)Yclfasficia Wem cM4 'Wyk

Iricr vict) ftca qi-ifZINcr 714tj4lT-TaT 312Tiq

k9-arl 5 ( cTik) cM14 W:1-3/4 . v-TRTT thTB fRr Tiftu

coeir ;

(w) facifamerct itfta arreRt et51 T1 wr cfle ct)4

stem aliflur at w 4)4 T`i tic14-1 t14-eict),

'Tcf Enftd ctr0-11 :

WTI zig fi15 11111‘rIch ffiTTRT, fkci1&eW

ti °Hell tg tRit IP war ze-* Wet S ara

ftwzr, amar WT 41. ct)+11 3fr. &Rena li

.3 evr cral—Ael v-znwe we- c wrara

co :

(T)

(a)

(t)

(t)

trR9 AT ci vid4 errfita ctre)- tg

fl fkel faR aitfra 'tor ;me cm fatel ;taw

-1?) wrIzra act) 74 fa-azr TrTee MAI and

*TT -161 TaT vIlaTIT

tgu‘ (RII) qRte giftr izr7 t m--a -(4 .9 $,AK 41t1

T al-IT5F ITT4ffiTh91ui weir, fRPm-a w:r

TWI ;A.m. &4-Th-F 51 vcrzfriT telPlci) VNI '14Ylki ch

TRI'l791 fa)ce au;

ta (RKr) ti 1M@ aaa coialercrl afrZ iiAiimiiafi

W4aTT 2 N') 4TI t)44 3itctr1, cpPie,/, TAIW,

W15 (u) Trael f# alcititurnotcp Tilautti

u‘arr 3TRT 3WT 3417 *R. \wit)..,er intoind weir

aTTITTIft ETIT4 TIT k ‘Tff-dR 6 030 T-Tqi ‘ing4 w4441,cc,

auRaar 1tIarcietcpiicitw Ti-fter pa-e-ga (et) If

ed .11-49 thn-Rl ThaTT 3W1 3t \3`141)`10

ctre)- .3qcoer -wfaccAcr ctreir;

itara zusitwIf W*41.tcp ft-cal gm eurfrea

maral, Trt—arraral nu igieicl, 3TrATtil afr 961qq)

ch4T1iRI-4 TrT4TeT Tar Nrdu cP'MII v-1T faap-rimtir If

Th'I .513 it-cr6cc1'( ard-Tra PiWf 31UT1EE5 facifUgcleT T

-RaRcr co4-cw1 ;

T‘icoicicr gq Te (INA ‘1/4)Lia Tieq4 TiffT a

72IT 311EITTO TTTERT91 zMTtt q),MI :

tirt /Tg. Te ciit4 aro # writ 614 4t ‘Tra

Te-a alt mpr aft;

191 RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

image3.tif

asfiagisus as“: 22%; .. 5.51:“.me mgfiwggmwfififi wgfi¢fiia§w§wamfimagwg . .EwfifiEEEE wfifimfifiwgwfiggfifié EMEEE fiEEEEEwwfifiw «EWEEE_EEE%EwWEE E %E EEEIMW .E EEEEEEmEEEEE EEEHVEEKEE .EE.E§.E.E@EEENE afifiéAéEwEwfiauEE MEEEMNE Egg EEEEE E¢E¢E.E££EE«EE¢ Kefizfipfifififlyfigawwmaigg . Efisfiwfiwfiwm figgfiawghfiflwwwmgwfifi EE.£¢EE§§%EEE EEEEE&%EE HE Eégfiwfifiuggwfimfiumflfim rgfifiwgcfifiwE§5E_E EEEEEEEKWEEEE «w E .E E we ma E A EEwwEfiEEEmmwafimEE EEEWEEREEEwEE. “E Evaagfifififlwwfiwgvmg ,ImEasdrrmExwwspflflwfifiEE Ewing EfiEfiEEEfiwfiwwgn—QSWE «WEE MEEEEEE £5 w TEE an 822% ENE, Ewma .% E E :Fch £me Ea: Emu E E E WW

ITe7T 317R1Ruf 41v1( 6 3171i?1, 2019

039 faf4=414q) -ftwrztt iTr4m1W arl-frR to-r-11- *fk 4gq4u7 14fW, M-4 TrftftRrzil, wq-Th-g-rq

cask s14lck-01 oi4m41, vrtfrzr 1)c1i uur irtfrzr ci>3e ctk M um-ferr cm41;

ElleM 3r-Imr9- arghTr, 3TRN irrrerzt flt ftrair ettc, lflrzr wrv crth4ftier zrr •?ikro \i-ww gir

v-Trfetff 3Kr fa1414ict, f4wrzil gkr fkliftff Trr-4m1 Rr4 fare-49). ar-1-€cr 04E;

(r) Rzcifeareio W <4,4-rgNI U21-I 31U17:1-0 S• lasEr f414 wrRm cmir uur arr 40(q4IuIcpI. 4h- 9-iq ut cN.11; faY114.41e14 Th MYIN-11aftch145011AS 1 qq,

3TRIF4̀ W aftvth49. E14r4r ;

(z) view gm met Tr4 444 arwarr sarr4zFr uqr 14zwict) W wcrnfr awiTra 46I thift;

wog we( Eu4711 g-ndsv-!;;;Xl, ?Pim <mil atIv caNifict, ffiTh-Rn sir-kJ ar4Frfs-ff4i m3r cmir;

(z) mrio tww gm A14ff crrFcr 3frZ vitt IR msr '1-49T \311c1a1 cbNj1;

(Z) taftrw cMuet, loqr •11co4 W ;Wet trtaTraff, -crrf4zil sithur-tr-4r &ft W f• it1cOH gkr 2.Trfr2rff

9i4 311rra-9. cfroir;

(DT) lI weiz1 g-a-zr urar metfr tkimr met turg-sfi ezrr uP_Tr 9110 TT fa14-r4o siav RFM-zrr !ITM 04 W -rz)-Trr uqr st1Ic1,414co fm-zrr 4lIIII I Travr t5T 31I 14tm, t1191-4 tufetrw cte)u.5. 3iTTR $)lit

itatt iimet ;rev wr 14-cra f4ifkiider met col 4Rtic gkr ?Mar iv<tv war 11kt1i9cP f4wrzhin aitraff 9rr-4w1 W ai-j-€0r fl;

(ff) zrarrealto- tg91-4 teTkw <t)cuss•( wr aufrTur cotir ;

(24) *tr arfe4zrii ar-vrr ‘,11 ar- r wl cm.4 wr d'irm A6 r cm-g, R -Twr \TN/Pi gro faxcifacmou met iv-}Timr

W 3ItfThitd- fWzrr u114 ;

q.NRWeietS WRTR Thtw3Pa1di 9TIT t

ain<bewr <m4 zrr \iicorTrizr-49 cm4 utofr tevr aN 9 tt ufrmet arlar wr cl-(44 *911 faxcincriegr trrz1 TR) it-er fIiitegg W Ififla Rgfatudif wirffm .14,4 A14 met ThT I51 Tr-g-r \JcPettirr 41,11 '41 P11 att? It<q)N- ft al1)e4tm zrr Ici14-14 Rqm fer W 3T-Tirv mi4crig1mtirmIt t

(q)

/91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image4.tif

WWWm,e-W,2o19 ‘ 5' (E) WW$W$WW$WW W, mm. film: W, ma—fima WNW, W mm aa—azqfi, W W 21151:" wmfiaafivafiwm; (a) mwm,mmmaam W,Wmmammmmwm Wwfifimfiwfimfiafifimwfi afivfifimfiaha—gws‘mg (31) flammaEWTfiaTammzfimnfimfifi Wmawmmmmwm; (a) W$WWW$WW, WWWW; (a) Wmfififiéwwmw ‘ ‘ ammzsmamaam; (a), 1.3m"??? WWW Wm m 's'fiq Wmfizmfifimamqfifitfifimfizfim; (a) mmmwfiafimafivwwmwfir WWW; (a) Wfiafimafimmfiafi$wfiuflmfim WWW—mafia3mmmmwfifi WWWW; ' (U1) Wfimwmmfimmw wwfifimmmmgfiifiqfimwfim WWWWIWWWWW WWEEWWI mwwmtfifimmfiwfimafi WWWWWWWWW Wmafimfiawmafi$awfivm (a) Wmfimmmmmwfiv (91) flflffifimfimmmfiafiwmwm mm,fiwf$mmmgmfieafiamafiwm mammamm; (a)fi3afia1m$ufiwa§wfimmfi¥afia1m$wfi 'mefimmmmfifififi maammfimaammfimw filfimfiamfimfinfifififififimmzfimfi, Wmmwwmmwmm m$mm¢mmmmzz: lQLRPHiDava 4 Vidhaika Folder (Adhiniyam‘2019)

6 tit41 3RiTtTIPT 41\31d, 6 31TR?f, 2019

4-(1) ct'l. fcl1kfle14 i-.24f#4 cm4 vmw at)7i.iR4iiii ftt8 t

aa 344-44, wilutu) .ft-S1 g 194-'114 .97 'flutf *NOK kf ?Mr

fAtlifta 31*-49- tk4)Isf Th-sf 1;137' few -r-44t I

(2) 1-1PLI1u1.11 134)-8 A f*ri I atm-fktz tTft, atztr4,

Au) Thm-r4 ilicot,a wr 1-t4t

144-dlcooi 94-Hur--44 -414-R-41 S't ea-el tik

R-t-rgiirf4-4R-ur;

9141.iu, ffim-r4 -14-4Rr 3-4311ET91 t TRZAT vL44-r toa

cl'hi -tt aut Elam- Aur;

w*ciiRkt fiI1iettT in 4r# wr4;

zu viciLr wq-474;

gifk met cr--g-&-m-r aft? Tat uzTr <NV TP110-1411 3:01Tatt in fkTuT afr iftq-M 1za ,K1iPc-4 ;cm cr)4 424 Nit4

A14 q wtciiPlci at:r 31n MT foRIPT;

qzoRiviou gki \3454#(-1 -,Itt 1 /43-H4tcj;itciaci 3tt21Zr4 4-21T

39-4_44 M u)144)41 met vTffi 4-24 d.icbI Usk 3117

fam-rt 9Ri4 wif 4-24-r fulvirt toat arruam-4-ra4f

9-4mer mitiRsor 347Lii ct9cW. rii4icorr .a4t WI

ITN t 31f4T* uicni44)41 m-sr -cHulucg %-trr ;

attzum 4%4 31arrv4m7 u)41-uiNI tik 11*ciiIlct tafferr

3futTraftin fu-aqur ;

vrt# tt4 A14 k i.i'tciiRlct -ffeutrrq, 141,41474i mil atTlas;

;4j ffimizt itt31-1etT TRAM sTrurail at-144 4-zu

faz ;

zf cifZjci4 itt. ibii1ef614 t9d 4IIlcl6u1RI ‘31 I

cll ErWRi rum-rt 4Y-A4131l in foqur zrza--444

31-ruura# Nutkuriims 3tuarQ U2-11

qcm4- 3.Tftin \jyrirf 3.N ;RATE 1TE-4 qui

<PI ;

arri-r4t 414 au i ftii*ciiRkf 01Td- # wolucg

vItar4;

1RT4 met ?4--A4-r Tre8-4 Thib4t t cr u4met egrTra

civicr ttetij5 ikfiici4 met ;

vzi4 timem 44 4 gzonvidet Ztrra:4-e4i 3i

qr<4 t-g 31-cff;41 vi 14 uRIT vmreaff vurr-4t;

fazu1dvio4 4 31tificfa Sr4 3TM ct4T-11Rt4 1 ffizifivr

s 3n9-01 ui vmrl'44- vcrrrt ;

itt Yøra1Ie1CThar

7eirCf9T

Tferra ;77 1.4)w u11.11

(w)

(TO

(1:0

(z)

191_RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

image5.tif

(mot—MIMWNPV) ”PIN wwm v EIBG'HJM‘IGI A fwwwwwm gwfigawwm Wigwam fwwwwwfiam—ma Mflamemwn‘emgammmktwwwm fwwmwgawgamm ‘mewaamlaewmwmm < < fawn mwzae’mmwmgnmmw - 5W M’wgmwmhwmmww MWW'WEQELBQJRREM 'MMM‘MWJQKRWEEMQEMw wmmewfi‘haw—MLQW . fmamgl Mmegmmwmwggmggw ' flatnel—‘Emmfl $213536 nan-m 9% W W m mutate 5MMW¥EW®Q$WE¥EE¢ mggfiwammmww Eammmgymmwmgmawmg Qamhuemmmwgewazmm mmwfigwwwmpmgbme fmmwmmmggjmfiggm mmmwmwmammfiwm . 5mm 1112:2921; WWWfiWmEEh-Mmm wgfimammhmagww (91) ‘3W'WWWWQMWW mm: Im‘mgflmgmmmmgmmw Mum mnmfimmmfl—m‘mfimflw‘ww $31M WWWMEMWWMUH {mm ._1¢____d___________________— BLOZ 'LELLLK) 91m; EMBLEM? MM ‘ 9 _

kicth *4T .31371WRui 1hJ 6 3TITRI, 2019

timer ml zt-r4R1 arraizrm—dir3ft tiiiiirfterd crii 04i 'i4cpflkf cm•)- mi -34,micr t tiR Hr t w-caTET

Eled faalatrievr grd ir+-t uti4 cii11t1t1Z

3itzrror9, RftraToir TIT 39-+IVIff 3Tizr4St S

N cr1 fclII€jIei4 TrA, Tretairall war wr41-zr w-drril

931149.1 4)14 .cni4co4i 34,h-dad <m4 A iii4 t, LIR

-NAT ;N-gai %-zrr ;

(u) aer—qi,4 kr4 Thni7-1 war tilqacd,r ThflhFtdIq ZtTkr9otrotio,

kr9trcr4T01-10, •41cH 34rft 31Ita fthl

Ilt-11141 Thnw uur TzlitTrail 45Titaizur;

\3ccritod1, 441a cr>1 w-aziar;

(ET) 44 arR:r f4A-oir, fim-PT air t4i; (9) 1t4Rui, thiT kb flv4 tkct)k. TR

faPP-ch'r ft-zrr ,tizr

5-(1) -ft# fclIIclLI SaTiENT g tiR41mir REIV TIPP. TWIN.

ATW1 &ik 117 tiVOK ml 3t-ri tell faTITTT 140 a Tad.

trt

‘3h-N. 1laY1 Cile14 SR, 1973 3141-9 wirfird

itt 'dug .gct, cgcla;

(U) tHchls1 gkr -11311*atd Threi fazcifatiiertr miict> arwrzl;

(Tr) \Rck :i141 at 3tr4;7t ,31-u1t ml 144)

31-RiT4t ; (zr) \ihy

kr4 ifThici,

striT9 cr-) arRrAt;

(u) Tri41/2Tu Triz iftif*atd 141-t1

TrriiRtz. -A *oft t arRrAt ;

,flve4 gkr ll11f1tc \icdsz . 14 w •4i,rer Elle14

Sf, 1973 Tenfiti ffi9it facliaslicie-i mi

ciptIfcl I a SlItilvIci) ffiszi 5 frAzi S MIT

litdifad faxufavida ziP.TrRrff cm4 Su-fra timpit zitrzydir tiro 1IcI IM

14R441vii1 Rit8 ER mtft Tritfa ;WEN ffaTT 111411v1-11 13.08 117 WAR ctr< t1114 siizrYw

tf 311 Trgrg, Tizr edi TirTra, TriTr

Trat ti 311:14 410-i t 03 31-ef Atm. •Iver

tItichk \tug ftur fallirTr A &Emir f3Err8 c9u mtft:

zeg iR faria -13r if a %z1 oi

f$41 ERTIwf t \UM 03 9I6S ava *AM 347tREr1-8 wtcjcl

\LI arErt REM<Iv4 tkcnisr \3t-4 ftraiir fai9r9 4t sw-diz 0.1 I1Szrr

tAsr ara lui44 \LNOK 510 31-11M A ii M 41-ff SiTir

3wdt t

1-H•NI Zig 31.1 zarrizr9 isrrzi4T 614 1,yer tkcw

arra-al* 349 Taff %-fft zritit gki fa,a it 1MtaTur, 3tItITTE (1) 3ittr9

iRTFITft 5NI 14,a Tit ffitevir t194 Atti

(7)

rqicb-r gm ;WM Thi 4-stlich-f Ur

krf I -IF

191_RPF1_Data 4 Vidnaika Folder (Adhiniyam_2019)

image6.tif

BC—VR’ W.W TIRE, 6 W, 2019 (W) mfiaafiammwfiammsfifimfiafié WWWWWRURW§WWW fifimmmmmmmfim W,WWWMWE§W§ ‘(fi) wfiwfimmmagwafi,nfimsfiwwfiuwfi7fifi W%fimmwmfim; (91) W—mqfiafimwwfimfimmuumwofioqfio, WOWOWO,WWWW%QWWWW mammmmmwafimm; '(3) Wamwféafiéafimmfiawflw; (ET) Qfimfimw,fimmfizfifiifiméfi1fifi; (H) fimfiamtfiw%mWWW—Ww 'fififiafimml Huffirmfiraafimafiwmfigqfimmfimémw Wfifiwmwmafifirmfimwmnfifim,fi WW:— (:5) WmmfiwfiammmwsaEmfifiwfia Wwfiaafimmmwm; (a) mwmmfiemfimflmmwmfi; (1T) WWWfiWWfiWMWW W; . (U) WWW$WWW¢W$WW$§ mama-mam; (2‘?) WWEEWWWWWW Wfifivfifiafimw_m; (a) WWWWW'WWW W1973$Wwfififirfifimfimmw WI mmmmfima‘fifififiamsfivanfifififim mmmmafimwmmww 'qfiafimfiqfiéwfiafiafivfil (DWWHQHWWWWWWW WfiWWW memfimafiam 1mm W?! (4)Hfifi,»mm$fimmfi03mgafiaafizfiwfimw Wfifimmfimfiufimfiamz Wflfifi5flfifififi, Wmfimmmm wmmfimoamafimifiafimqufiafim 'Hfiafimmfimwzfiafifimfiwafimmmm mmw1$mmmmaamfim,$wmam WE}: mfimfiswmfim$wafi$gfimm$ m¢mnfiammmmmmmmomm mwmmmmmmmmi l9l RPH Data4 Vidbaika Foldcr(Adhiniyam 20l9)

8

'cc'( Slt4T 31331tINIT talc, 6 3TTTWE, 2019

6-(1)0T 5 T 3TO19 iTtd. 3TECQATIII1c1 6 T

ittchK wr Trg Trwtrr4 Aim fbcriasficia met wrcr-i-r .D,qr .41.11

attercLuf t arrvizr-tm .101 vr Trm-01 1

.(2)14m)vI4h NTTzf URI 3 # faRfatd aTeraTraft 30 idT &r IA 0 if

lo-4 tkOH r 3-frteT 3911T-09 airccrr gro-vrcr2T-Er W 342T atrzrzr-rm

.W# \414 W f4-9-fw aitrw-d4 wi met 3NRI T AN7 AWF ct) 411 I

(3) gra -sw.fluRn f4TRI gRT 3 T. 3crectf TT 39111-g9- cm4 If fdm-a-

I Thrti t1ch1•1 uv4.ict) Picvi M .wtr it4 Tr? 31-RTZHICN Cb) -Per

*4 CA vrWr um 61,11r

7-M1M 3 T 3TON AWIff 3171-6-9 31TECT 117 1a-17 0•<4 LR-clIcf

iR 'i'i ‘11'ct)k 5I Tft RTHWAT9 1 /431icif t ffi5 llizi)u10 ffiTTE! TNT 6 .4

ucrtiwr (i) W wr 3ticrr-64 fiwzrr fl'r crg wwritm 344-4,F9-r

gkf ai1tzrzr-T5 31TIR 9T11 WAN tkAcr aro) met qcifhtieitr msr

ar-v-r t *Roo' 1

*f 34MPR 3019 Wilferd• r0-if v114 cila 9t "WcIratlicigAl

9-111, 6‘1-1 aSr TWIN <mc •411411cr ft-4 -r4-4 I

fa 1-asi ir14 wdt tit .414 W qz-cricr w writd JPuiwi W

mre-f tk0k- gkl• 3fItNRATT T 30T tici4-1 3Nlit 2 If \31-kiRqd 3011

fiRviertr W tilt) arirr 0910 q:ta W411- I

i 31t4ftzPi 3Taif9- WITTferff TIT I 1:1- 1TfRlVid4 1,0

IIPid MWRI 6)111I

8-3110 1 #rnsiiRci f€iii fciPIwew, *tr W amfr9 .Pqfkr §c 4T4

9- xci IId f9t1 16ifkiiet4 31t1T itinr W faxlisfifok W f4f#-ifi- .16 I rl

ro-facifavreitr W wcts-4, tar mer \•411 xiitgraft,

3-ffrO, ar-Itzr, *2! 30 ftiffRtR1# 3-Pa1r3ll metZZJ41Q41 4,4 snit 7-4 wr 141p'( atIz arf49-It cor 6141 ait 1cr1av.ricv4 ETNI any alarrErml msr

W Tr-d--44 W fr 34-r-azrw cljc1Ic4ur 3Th 1-1t.44 14qirr ctro) IT tizfRi c0J11:-

3TWITT—la MT

fkin unir att I4H4 um)

9N1 arjrfia7 3TT&I1 WV RI5T11 oll-11

9t 441 ?AIM mcf wrcm-r 3121-41 MTIFF

Yr! aficli4

ffiTPR

ellair5c11 1ktr redt)TA

Yel alloW

30`/41

(m) %au If 311749•-41wRIPT 141cs,q09. . mer 3TWIN 9-1tren 3t17 3rr9--d-r-4-#‘44 jyrffrth, 141kd- vitvirr,

ftur ar:r Ift 1-4cr mer treatil

cialccr W f4m-ruiT 4r4 witcr l jc;

thfkIN YTM1131-1 If31aRN;

(ii) 3T-<sT1J1 3Ttzrzr4 ;

(Er) TzazT -q<61<rwir, ts-r4F4u, 014-Aardr, tii98 \941m1cir afrz 3r-Rttfrzr 31-‘744 7-4 fOcr)cir Tr2ict,4

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image7.tif

311311—4131 W WWW- mm mm mafimm. am afimwaw W w W TTTrI'c', dame, 2019 -641)m5'$mw%fifififiafimwsifi$qfimufiz mmmwwfifimfléfimafimfimm W‘s‘afia‘sm—wmaflmh (mmmumafififififimmafisfivmfafilflafim WWWfimWWW—WHEWW—w mmmfimfimfifiafimfiwfimwml ’(3)fimmmafimmmmfifiw mém,mwmfimfimfimfinfim—wfim afiafimfifimfia‘ml Humazémfifiwagmmmwfififimzfim afiwwwafimfiméfismfiwfiifimfiweafi W(1)$Wavla§qmfim%fiiagmfimfimamfiam mm—wfimfimmwfimfifimfifiafimfi Wéwill (2)wmfiflfi$wfifiwfifififiififimflfififififlm$ w,wafifiwfiwfimma§fififimfififififim (3)‘fisafimmwrfifififiafifi$vwmqamfiafiwfimm$ WWWWWWEBWWWQfiWW Wfimmmwmm: (mefl'HEFGIEfiWWWWIWWW Wfimafiml 8W1fimrfififianmfisafiw, wafifimzfimfifi Wgnfiafifil 9—W, W Rafi—wan 312m W afr W E?» WEBWWTE‘WWI _ 1mfisafiaréa$efimfimafififiwfifi$azvfia W,fisaém,¥fiasfivfiww&fi§fiumfiafiwwm,ww Wammmmmmmmmamm WEBWEBWWWWWWWW WWW— , (E5)f§1&fl I3f Wm M Wafi Wm, 319mm, 913mm 3T1? Win-i=1, fimfif afidcflsfi uh, Wu E13141, WMWWWHEWQfi fiafimfiafim WW$W$WWWWW€IWg (E) stfifiw; (W) Wm; (H) W W. W, Wear, mm; m an: WWWWWI , 19I_RPH7Dala 4 Vidhaika Folder (Adhiniyamjfllé)

\ickt( liaz131FIWITT 4luid, 6 317Fir, 2019

11-farIcl) .1Th-T9). 3117 tkc0r1 gki 'Wig-Wig TR• Zle

I'd Al Ole) forr-M01nuin+11.11- artzerff facAutcria W f*-ARgcr iFttTit, 3T240:-

(w) 14rr A 701 -070341, view wro-tma trq arwifta co4, ftrawr wr acrw4T <m-ir 3fi7 VNT aar vii-r 3frAT4-rzm aftyitiZJ -14tIH f41im a4r4-4-T

emli, •

() Rca A \ill -sikgrafr, ftiv -1- 14.ricier t3tu 31/2-41, Item A aurr4T 4)*-11 afrz tinu v -r t1 &WS 44

t Mitrm utrweer groir; (Tr) friir11-41 74 ucwicr alwriawl vitt0 41u1Pe,0

Sr 3:1 ormr; (Er) 01 W artfra •?6,4 F cricig arawfb. w3,

cerDvNI urfter te-gicrp-r zrr Thei Wit 31-1 LicgRr arraR trq u 4iii11-T:ra acrrIt ZU 3TI te•Tgfrw frittc114 9-419 grfrir 30 a 30 ueificr wr3Tril 31 /2 431 /2 f3teil9r, w0r-IT131 iIuT aM taffitrw fdPitenrarl • c)Ir;

(a) pier ti,«W 1:0 39*-4-ff t 41114 \ivair TT 3TRT

A-4N ctr011; fa4119<t) Writt-Tan 3t17 l‘r4 11•401•Z 91-1 3FITIR Pa0co tr-41, award tr--41, 3:rg- &raid tr41, *16114) rg-Ri 1:0 aM faYgnacig ir arcl-Rra avzi artarcm war &Pit tit

30:4P-Ta crroir 31)7 dcf)Pcrr R1kiii cbtll; 1ci14cpcp114 30 3T- 1 ITO wr 3179 /roil war tp PPozir tr,frir;

(w) fth-01 f4ifasucia Zn t1.41CH tjWRfrff cia4C1e4 f:= 4 raftrTz vrr tr, A war 04 31 /2 ?Tr itt faRRte,

ara W f4zsa 0•011 ZIT epifra;

(sr) i aM ittra W fcifavrievr zrr ui ar

0•PAT 31 /2 44 014 31 /2 30 01 /2 cr41-A- ffiq ‘1-ir YRcif€jictx raft 4,4, 3:Fs-A4 <mil, 0-6-410 cr,tir TIT

\3•10)- c1y<•11; (51) TOT 347 f01411 fdPitacv ug flyileiraft

Zn 3TRI Met wiltr9T 30 ar-134Tur anii,{ Rxcirvicria A wzr 33:r-W içciiA 3rT0 cot1

arrosaw (z) arta-dr-OW, vilqR-14), 1441164 44-wl aM 111%11%bl

0ftaa cm•-ir 30 3-4 ugi-r <froir; • (a) arr4r01, w1cr9T, ar-TeTur avz \iicor -gamin

tii U211uoil fq Iar-azr aM .9191-t1

<pc-41.1,01 aqicpentit u cal cfroit;

(a) ar 0cuarl 344-44 anir att7 \nct 3ti-2113T1 zIT Tt-ret M Trmr 431t Urdiv-Ti

ti afz-Acr 61-ir uitir qW&era &maw 'wilt;

faxorauido 01

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image8.tif

(slot—miéumvv) 19pm mumlm v BIBa'Hdu'Isl '-MWWM1&@W§ {MMMgmMmmmmMMQmmfi wwwmmaemmumhwm ‘MWLEEMW mmmmgwmmmgm magphwuaemfllte'mnmwkmm'w Mfizwmwmflfimgmwm {a ‘m mm we mum @ was rare Lt: wwwmwummgmwm .mmzfigagaha mmnuzga MM h—‘EWW QMM$WQWJ®$®M$M mmmmmmwmmmszmwm— fwnnmmmfighggw MMLREHWQ @hfimw wwmgmmmmmw . immagfugm gammmaghmwww MWWNQMWJéE @MMWMWMWW Maewahfizmmwwmm ‘Mmznmmgg .mem mmmghmfiwfigzm mu. . .uggmm; L92 LEW 9mm: hue W'M—lfllfifi 'lhufiéi wawwwwfiwmww wgammqmmm—mmmmmm fizaihmwuzwmmmwwmm SMEQMEWA immmgm legnhlfimnuhhuemmmzm #wmmmwmmmgkm .m mamgzmmwgnwwwfi mgmgznufiagemmwmggagg [51219 -mwwmma@w WM$WW$WMWW§wmm W 'etoz'ws‘mmmw (91)

10 VW* At4T 31.#141- 01 INd, 6 317Ff, 2019 - •

31tre4zr1 wall taNi4 39-trR zmu -ft-Paft \9014, f41-TPT,

-4 TIT tcPcsf QATItrn 1011;

(13T) qY41C11e14 k wata fq mr4r tkcw arm RRila<t)

f445rz1i 39i1R 91-11 3.74-10ff 43*-11 f -at 314ra

tc-qicp4 zrr Tick-or .tf4ftaa cm4 Etter met -01- arRi

1-Ic9 .11 t Trt-et t;

(a) mem ati 31- 1 SPIT# Mei cl-r•-ir 3417 \ilmr Irma sgicr

0, 4r;

(2.0 afta-rail kr4 araT a1ba IstAI Tri4-4T aramr cJvjf

tir RxgRegem c1i4 TRt;

(a) %ciRvide4 co4tuN1 3t1-4 mat t atzr aroma

RPeAcr -cmir attR. vola• cmi-tr argrre4t \i914 cm•-ir .)ttr RciDf.gem arm-zrt

*1.1$11 v114;

(a) fazgRsgew t4.1-cuRql- a-Rrezr tiii-gru te'n'-4

Tria-4-a fq wa-eur s-ir;

(a) Rc1fdego4 cneqm aTa criwr 311 1*4 -crer

ZIT awa- W1rT wr 30ff, wor. 9-4-4T cNir;

(14) zit iriiiaa 1*-11 ft 1‘3.4 *N471* * 10 31-1144ff Warzr

faxilatgew t ft-di aartit zrr ii11,1,a gm ft-4tr 3Taa-

Trie ir f*(1-mu1 zrr \iti4 \iticnr cp14 3Orm-R zrr 6ch 6 4

TIT 31 r-q Tifka ta-g-rt \34 Ejtat -14)m wrz)Tcr;

(m) TIMaT 4T 301 'DA 3TIETR 1zR ti?r 3P-71-13ffl 3114141, %IRRocr

arraral, wazigiaratt, 3mta-1311, Ii4, <riewova, 14Io,44474

3frq amr ceiRot4 mf4zjaa <weir

ll1 C1Id4 tr 317TH cm441I4frf 1141-1

*11;

cli4 amzrzra att wI17 •1gr 051 31-141-A-a crroir att?

96.1 c4r; 30

(a) ttr arm *14th0 mi4 3ft ctisei fdciREficizr t

zrr it41 met urfkr fq arrtat, atustfirt

t16iercr, t

12-0) ftfrr- tent owl:pi-4 uaxf, 31t1f44#, ffctlk 4-414t• 11711

LIP141-114ell aTtirrke 31-1-40 WàT Trfiri%NI artufta

,su gia uftrat 39-4TH ftir wrzlirr

%gfatgc1=4 1f410aa. ft 1clRk1Ie14 gkr TRT# ?St *I

1-11411424 /Wart 914co, Rflelificr, Th-trzN't fazajfari 3T-grw t

artzurt—itom 31-14TU Rzir—M-40 311.40

&P111

za woo Tit aril aft? lldicIeifZFtIi t grIT

13-RY4€11(-14 Tr#1 f?141, inTrff, vIA zu aTf

Om 3N idxgRvicia zit fAtiuicr 614ir ft at DA afro t

fk RA aitrtrer, aurrwt, co4-cuRce-q ticto, Tcr \ittil- Oxi Rv)-

vg4 fq \t<-144 4,14 ca writ cm4 in (461 tr trgoct) cm4

64)41 cm4 EAT foqm zrr aigi-ga met 4,14 Ertam, itr 111 t,

zur zwr arfOrftra

sr'avr teffor15 111tct)

191_RPH_Dala 4 Vidhaika Folder (Adhiniyam_2019)

image9.tif

(slofwefiwmpv) 19pm wwm tr alea'Hdu‘lol Hm maéW—MQWMmfifim-Wfi) Ikamfiwmwmanmmw'mmaamm @MMMW%MW&W(¢_ Immmsewamk—m mwmwmmsamaammmw w~wfl‘w‘m#wmmm—u magnum mW'MM$W@WMm wgwwmfiwmwmw (n) ‘ mfmmgn mwmmammwmm (a) . A w‘ Mkflifimkfiktkfi—‘EWQWQEW L92 m 225% @ Mm tare km hue Lam—Is 'W'mwafimmmmfimm (9.1) immwmwgmmmmm mmmwmwwmmaw mmmwmww$m mm¢m£m£$mmsammfian (h) Emmwhm'wlgzwmm Aaammemmmmmaammfi$mmm (h) vimmmhggw 1142M $mmmh Lawn WW mew

\ic-th 3rflitTRuT , &Ter, 2019

urR--t is fW e aet, aiRrn i.iilRRuf, ro9141 ar-T

feu*ciii ift-t toior4 stuft S ro91.401 SafrfOt Tcr ii' cliii S10114

facnvietif 9 IN't 991 ct,41-coRiI tt 941 30 itt lod,Lict,4

arRaTur, W14H11410 ER ,flv4 dctii M 31-ite PHear-mo- gm ft9r q-rtrit

14—Rci theta t 4-1 arf4tat 6141:-

0) ceiiIRr 9r 3TEzfei;

(2)-Alt diI1YI IT ZEfialei;

(3) T.:614ft;

(4) lincteillra; .

cgef RTIt-4;

i4M-ft *SET;

IPI-?[ te-z0uf MT .f-0-TzflulaT;

(8) fkkt4TM;

(9) 44t-rfilct);

(1o) 5c-c towntict);

f'd- artreat, AR.

,t). 31w4 3TRMTt 7). LIRP14f giV tiflcf WEI v1I

qVc1aulc-I4 S 3T1IMit, &4i

1541) TarkEllt/31zziei Met fA444 zRTT fte6d. ITFPLET nit fTher-R

af-grm co,“). itr9 94 tt 3f4tr fe4 sffift ffitr-9 gi4 tr

aft

(2) teallia/31ZzleT f flClIcl4 MT WIG 6)1111

(3)TaltlEfffiRTEz1ei u4l MThlzi Met td-et Wall jci11tioi4 M ti11Wt

WIR‘ft Met attterd-r ikiti

tit -4 IT-1?ja cM4 TIT 31-Q1W, 1t virci, 7).

31W4z1M ‘11441 v114, cM4 M LIVUld 441 fsrea \ictin-r It saitrcrffi/artzteT

t-r 99r 611 faY4sile10 M f89 9 9 vftvrrt 19t99. 9-09 t qkz-cia

ciqflf1cct tkuil Zm *ram cm4 q ffiffird afra-4 gi4 warfrgffi/artzteT

3Trata faf4tt fk9ft 01401(4 tlifitc1 6)4 M 114 apyr 13)--0

ffit 06 iitc1f t, tRri rural 9 sotft f9t-r9 tar to-t ti arar449T

yea- 0,e111ULICl/UEIT 2fELT 11T:M Tru ft nt 999-R-r i oitt9 0I 'ct>4 t -14

ct3cA4R/atate 3r4-4? 1I414 ?tar aril ctielliql?/3TalkT M ELM PiM11Rsjcf IRWII &i4, iqhi

(m) qxoNencia co14 Tom t off44-41..tt TriTr co•frir ;

(T1) rff 3Itffizill Met tTRT 17 3ERITZT (1) 301# M,FEA Met

ffizi-Wf qn-if ;

(#) T41 3409-99 kr4 9019 99-r4t 941 *j9494

39-4TR. toatiffi Z11 6thir;

(i9) -@11 31:f iPkvii. 1/4A•4r irR1991,4(11 gio feo fi

.roa

(6) rter&-G-t/3rE9t .14cif41ici4 stfacroWila. /44rar& aort.

tc't 99-41* t NS *At 99-Trt 3176-ftd c041 •

laqfE4Ie1.J antr-sit

tarRfcrfa/ 31F211R1

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image10.tif

8.351555 :2: £25; q amaxznalsfi _%EEEE¢E% E%EE\%E%EEE§EEEW@ . :Ew E§EE&E.EEEE . MEEEEQ. EwEEfigfigéfiE . ME Ema figéwsgfitgfigfifi ”Egfiésgwfifigfifiv . 1§5EE5§EwE§EEQ ‘ _EEEEEEEEB§\§ @gE.Er§w.E§mfi&§§y ”EwEEEEE E§%E%EE&E%¢EEE wfifiggfifivmggfififigrga EEEEEEEEVWEEEEE @EngEEmwwfiwEfiEEE 5§\§fifiEE.EE%E.EEE E.EEE%EESEMWEWE.EE£W€ . _EE§§.E EwfinwEwwflfimEfiEEmfia\§§ _Efiwmufiwmfiflnwflwas\§€wm~€ Em fiEEE.Ewe§%€E%EEEE Egan BEEEEEEEGQBEEEAE. . A . _%.Eswpmfie5 EEEEEEEEEWWAN, . éwEEE “ERAS. LEE? m {E v EE "4% AAAA,‘ 0') v In 9 0 “3“.me “marmfifiugmmwfiu. WEBEEE «WEE A Ifigesfifififigfifié _ .55E EEEIEEE$EEEEIE_E§ «EwggwfifififiEEEaEEw Efifififiggéfigwfigéfig Efigggggfifig : mvom.Em~EE§EEK/.Em N _‘ VV

12 \icth A:6T 31391gRuf Ij1d, 6 314-i?f, 2019

irr 16-(1) Uri 1-1 /31:11alei ter N14?1, wRit ffiwzr t

cgell MEW 91\TI 1:11 64 ter fe). A aft I

(2) Adarl wFTIEr-It/u-Errarai, co41m: TA-RrErfa/ 31uTe A TE67## 4,91 uur u-u-A 31--lqftult 4 a/Pd. TITITR)*itt 312laTiff

ch if I

(3) telliqr4/31ei iM Tre f&Rfm 4 •PfTeR crra wrEnt/uErraraT 37E4 K cs4r-Er *lour ti

(4) q_a 14c919q-I Ter si4 SIR:MT W:f # 1,411

414, &Kra ‘941$1). 9114, si4 t.ift ‘3o1wr Th5 crt w,-ggruruyucritzraT iN T9 s!6-11 2cr 4 9. tr Vit waRruit/aitzraT m11 ThwrzT 34-14-4-9 t dcfarr At*\31Z.viRgyr si fflit§rd. 31-RTF ;tit 43e1II914/3mura1 arre-cir izreffrse f4-9-Ew t 37/9-r i-r9ricr 614 W TO 31-Erm 116 1**4 9/6' iisor t:

zrt ifs i utrarriT 314t6 9/1491& ti4 t EL4 wit TaTI4EA/3trit2re Tj9 at wr 3T6TR R-4-19 ftzrr arr

(5) At tTefflTit/341?-46-T 1)\LII 90.-1 3TT*R6 faYrasiicic-I t w:a-grEreuyameT wrr 61911

17-0) 43ci4Ia ffizir4vr wit ffiwrzr EL4 t

sa-grErft/ante gkr A aft: zru ftcrierEfir 3TEr4 tititiet t Erre .-1141arr

tim 4 1 ri

cgelq14 qiz arlti Tri ticc“ 44 6)4 us, A itt 116a ER war cO4ni crfa IletIlagrf VITep cfr?-k TIT 31W:19-# W# tt

ujjtj, i1 arr-uszrt •69$11 ung, ti4 tiv-su t ffired. \3cir-rr toy 9-9-r 2cf writ( ffiwrzr, ockfkri wRoft tsr 4.tifZgu crwth Ett 9),(14 311tZT #2-1-116ThIEZ Piiot 'f -ftrff arr-a-vr gkr 31491 IT6 10)17n WI ch$ \Lichen *

1-N•cl Tf* *i-r uErErrt t 311k 4,14 si4sg1 t EL4 4:044 Wr 31-9-u-r4iN 314TF ugyr ftzrr wRiTir

(L) ,1,0144 invreiLr wr ;Ppt sizigicis aft twitrt 31feri51t 1i1 3Nij RY4641(19 itzur wait A altarcrr f4ujcrir 31)7 9 6 chi 99 wr 3Itz1ei 6Thr Tau 3110-Puzr9 Wall 6-911(6 6916 9-4 31gre-A, fafkzit. t 30r9- .1t.4 Tr.4 sielyRtic in 3f-44 teT9 ffiwRil 9-2T1ir,;ei RPtuqi tsi-Trt

(5) tiOTItRit/3P:46T *i1? terat-GvuEritzraT itt 341tIfte1t teivRRvonvieur 3Tareru-r

(6) qk 43ep-ar itttzr 4 lit-01 TrP# 4 gi'd q) Cil cNri aTr-474 ffit 31f4r4a9 gkr zrr 314k 'WA 3T-4:1 MI co Th"f i1iiMgcti *1 6)- 6* 1; \L)). chIticila V(' +ROW t ittf 311414TW. UZIT c1cc-R-91c1 &EA spiurgt itt ftEr18t aitrwrt T varwrt im.411fUly tirr, iiftAti-Rtrr 147,4 4 cti-r R-4 A aver 7-13w Turral wr

77-1 V* qR wq-r4Td. arfgrAt ZIT Milch01 trl 716 # -64 wart testrIZ-r gkr ug itt sr41 wf74t 919err altzrei 45't ifi1F& fSqr JlI1II rtRP -44 atruTr tirri

37Tralhi

191_RPH_Dala.4 Vidhaika Foie (Adhiniyath_2019)

image11.tif

35W ‘13? 3W1 ‘1 in 1 513, 6 31’ W, 2019 1H1)mW/Wafifigfifimfizfim$a§fififi W/mammaaéafimfimafimfil (2)W$WfifiWfi/WHHWW/ mamwmfiwmfiqfiafififimmzafiawm WI (3)amfiqfi/awaafiwmafirmawfimmmqfi Wh/Wamfifim—WE‘WE‘I (4)ufifififiwumfiafiqfifimfimmwfiamw fih,fiianammsfifimm$wmfiufiwafigfi» WW/wawwmfiwfiamzfififififisfifi} W/mawflfimzswmfififififiamfimfi WaWWWfiW/Wfifimfimfifie Wfimmwfifififimwmfi$mafig WE}: mugffiisfiWREasfiwmfimaEqfiufi' W/wwaafiwfimmuafiWWl (5)ufiafirW/mafimfififimfiaafimfififisafimma§ W/amafims‘l‘nl 17—(1)WWWWW$QSEWV§. mafi/mamafifirfifi: magf$afiqfimmaafim$qfimgfifigfifiég WWI (2)agfiqfiwmafiafismfi$mmwafiafiangmsfi a—cfixrhmuzas‘mzwmt - ' (3)3fifisfiw,wfiafinfifimmammmfiafivw WWWWWWW$WWWWETQEW WWWWEBQHfiHfiHTWWfifiWW fimmamamfiwfiwmamm, mmwafisfifififimw? mw1fiiwm$mmmma§gfiafiwfimfi WWWWWWI » (QWWWWHVWWWWMW WWWMHMWWMWWWW, wwwmzfimfimfivfinfimmfiwmvm WWWW$WH§TWWL ' . (5) W/SWH em ufif W/ma 3% Wm ff mmzfifimmafimmml (mafiafiufirzfivmfififififiwffwmm WéfiWMwafiJfiwmmmsfififiWmmfi. fimm‘fififififimwwfimfiwm wmmmfiafificfiéfiafimmwfimfififimfiwfiw W,mwwwfimfififimfiwmfifiwmmi mm%afiw®ammmafimfim ‘mafiwfimafiafimamefifiWWmaafifififiE' WWWWWWWWI 19l_RPH_Dala_4 Vidhaika F016 (Adhiniyalil_20]9)

1 /4icci S1t3T 3131TURTIT quid, 6 31713?1, 2019 13

(7) tCILlRI 1t 114r1z11 m sizThi an-4 451 t1111C4 c1) '1( \Lir -es arRrfkzre attq e-ctitff 61-11a Trzl l4RIjWjt arterawl aM fI1wif gl'41

‘111cad 14)LI1 v1111

18-0) -siMse1t4I?l St fkziWr ci2,evtia gle ter ,rt wer w0711 aitq vit `trig d

ifacH4): WE ;ROI- coni 3Mte cizmI451 4,4i4.1 (Ant .)er ffis ii1fli4T gkr iici fakir 1 /4414 aN art/In-a-a 3.1.17 fii4f \144R)cr Rpctr 7Tz1 I

WTETTRT (1) t 3Taff fkgWf 1.0cge11-114 3.1MT4 4 31144

cvcic4i it arrd-Rwr we-at in ffi-4-6 ct) 411 m14(11-1R'lt 347 OW 3PU'Ir iM \AK ft.ff-graftff

W w-datt t Moe co,t4 sep-A St ,e6tcto1 c0 4111

liractrigia 3-T41" EMT% Thl TESTI. 311Wf c011t 1 /43411 MKlult

mTh-R1 gm arw_trftu fr wrzr

19-(1) seref*cr artok trcer, ecir stff atlq fer St l-a.)tit aer ft faa 14741 1 /44101 •

cgettacf fdzc111ctiet4 a aM e 3rfir-a-S arftrefitu ct) a vac( 614111

settAct Rxcactiettr it arfk-adt 3Mt11411-4 4n StTr4ff

3aReecj icrtt<icil 6)4111 Wgin1 fgazr, opitacis, RctiqRcr‘ 3117 wavr

,t-ARt eau f4kcActleitt artztrcra 4 f4gMe turrw -c14-1 •LINR 41 litff

TrIt4 61,ir attv tp-tic-r TL-49-r atftral Trgei tu4 t wur

61,ir \1•4 ticeic16K 3TrazIT eri 1-P1;44 31t4Ite aM fditptI feee cri4qRci4 zrr ',MLA UIRT tr7 311*Fff 3TR1

cpck'i 451 11'1 f)r$414-1 ctit .3.4 we 3TRI171 it 3TIVR rIR M t4 451 BT

-tI1i1I 20.-cr- rw TrwwRzat a ffirr trrd 31 a q-rtift stfi7 iwttft

114t-iei• cAiir atl-q aTM't 451 tit4144 c0+11 1 /431,Hr it •fau D)eir 1 /44141

21-(1) faccf 3TREWt St. P1ti,tet •€11Z-r 3kStwrkTir

vi14cictI ThI uctlit c0 4 ir aM wr eteqrt (Ow ‘31.,11 R 'Mite ital.

viitt 1 (2) itm -arlbagt qck-r ‘.-Akt 41 tlarf i1lt4 6)4111

22-101-71 chet1M TiTh-Tz/TUfal; '01W .A4•Ach atti. ts4 cgc1ITiPeRD

Trro -cavil-44mo ar-4:r SrRztt ?I-ft ifkizrt 'Mil Th-nal

,A•tit fau uliqi 23_fac.neud4* -P4-11. R.Aci Itifterr

vrr-et MM-R;

(11141-04q;

f4tr IS;

f* f. cilvicr GM;

. (6) ticolo cfhg,

(7) 3TU1ZF

.(8) titre eftrea

(9) ITt&91 I-A14; 3117 (H) 4t 31:1 witr-t-wr, ffl RPi4t wefhaiAid4 W

%,.(trtui Qfdcr f4)?)- ‘414

92.$141

toit4V.46

aTR4 antt-rt

ci1awe 1t

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image12.tif

game; WM WEE} HEMP: wm (6|0Z_l"€l‘!“!'{PV) 1°le ”HWHPEA v ”led—Hdlrlél . Immwmmm gwmwm‘WMgQW) .' W’Wfiflflé—h (6) ' WIRE—I16). ELEM (L) 'g‘ikERJ—‘Bki (9)' NEW (9) ’WP—fl (V) ’hhghlfia; (E) 5W (z) 1&2}ng (I) awm—mmamwszmmm-Sz. _ Immmsgwmafi wmwmwwfiwwwmaemmuw. MnfiwwmwkmmgamMMiZ A Iwwwmwngmz) I ‘ tall-Q ww%mwwammwwwww mawmwawmmfigwwmm-w ' A Ital-£1 mmwmmm1$m¥e®wmmmmm mawwwawmwfiwwmmmm ‘ Ime-h magammgmfiwfiwmmwmw mmmm—mmwfimwmmmm ‘wmm‘mghanuammwgzmwww mwaatmahaszmmmwhsmfltmmanwwm wmwmmfiamwwgzwwmw wwwg'wm‘mwalwwfiaw Magehaummmww¢wwmw® . Iw—gng—Mn WléEthmeMMhfiawfi-BQM - - Immaaagfiemah wwwfiwwwm'W'wwme-m ‘ Immwmfim Wgwwmwmwrwwwm - I . IMMEWkIMEWiMJEP—‘Mfi ww—ha'mwmwmwmwwwww a Iwmwawwgw mghfi$wwmfiwwwomm - mus gwmmfiwwowwmfilmeMEl WWgEEWMMgm—aawfiggawufll .- - Imamewahfi mmmwwwwwwmmsams wmmwwwmwwmmm El smz'ms'aaumummmm

14 Tra7T 3TRI1URIIT , 6 3.1W1, 2019

911 Th-M-112

mi4 14R94 . .

24-(1) •Ylitn ffiTT4 T 4101. atiR. 31-4T411 i C0i4Cbie 1ti1 51411, Mitt'

faro fSZIT ksII4

4eilia4R1/3ThlfeT ffizrg 19iT. sipti) MMTLT .415t .4R

cAflr ath writt Malt arfifT tuT cogt atift :

Er? zit fl15s9TtErf4/wraT, 131-r a TITS, sTRit ffiazr t ctet

TraTzil arRIff -) taut 3T-434. farff ,o)Lr twrraiftd- wriku trq

Thm-Rr ftr trTj arrthhd- qv( •tict)or t

*,(1. 311tm7F1 31:14-#-* T 3Taft9, TT* MT1-4 fki11tiicia That

ffiazr t),-r ij ct)id m-3Tfr eru wI Lim qi-lifa-icr - 11)141 at17

312Ifff

RNDttima a Cog 4t1?izil 34'17 coitico911l \LP-H4—W90 tH

Trtur cm-ir akfcineticla tt si4414, jgrq afrq f4awr

\3414 RiaNT,

Vci T°T arR- Rita attq a Agra* 341q *Urrail

tt a-grr 1STq ctrmi att- ticoe44 €M•11 U21-1 31V9T

ird 0144144c -11 -cr-g&Ttiir ;

(Tr) WO* tg 414 Tr4 jf-Rit ijpç 14 wre rffTrit k9T;

(Er) awr fro .14) vii&TT Thegic-r em-irt

25-(1) T14 14ffi4 faYciratile14 TT Apr 4,141-11(14) ffiTRE 6‘14111

4,144444 St ta-- 'it irovr arrzn-P- a aft 'ti1 f$ re0 zif kr114 1

fac11411cHT T wwai, 3j-4U 3ft f4uj WaTT WiTTer 3171, sttlyRe44 M1ci.0,1, faEtiegr St p-Lifeti 3I1 ffitrzh a Th41c1

wrftrff <t) ,11- 1

(a) T 3tgrizrir wra-411 wrzfrff cp144.444 .P1:11R.gcf Incleit aM T4T1 04) :—

(t) fVci14wttr St ‘914( ccr at)7 fAtret a a ah q4Dcr

crrmr;

(rn) Thcrfactiviet St aM 1an4 Agit war ww t1144 cd

arf4a- cm•-ir ;

(aro Lipf-;e4,4 kr4 att•irre-irt qthrir, thñWm cmil 3T2TPT \34

qact ctroir;

(wR) fdf; Ycl VIela ttiNuT

Trt 1t41 ffitit St Sraiff cM11;

(144 faVcatlleiti 61vId 39-111ftff c(P(.11;

(13:) 11R1e4.4 3114(hist T arTerR 91,11 ct14t, 3TRTITT-11,

ffidff vi -spot, tiq<p ati? arR:r InRctlidcr) 34Rem ;

19I_RPH_bata 4 Vidhaika Folder (Adhiniyam_2019)

image13.tif

(610Z_W!“5‘1PV)J°FIO:I wuwpm :1 “liq—thflél 5MWWHWM'MMHFH 'W'Mfimmaaufimmwm fwaamaamaammm(m . .fmwmwmgmmh mzhmw$mawmm$wmm - 5mm {EEWMWMLQWMWMQ "" 5% Eggs: @wmwmmawwmw - fm .mwwwmwwwwm . —rL4£taP—Muemm ngkwmhmmaemaawwrfim ‘ Iwawmue W¢WWW€EWwbfifiwa 'mwmmwhuem‘wm$mwm(€) Imam WQmwwwmaamwmw Iwmgmmmm.mwmmuksz Immanamwawua'wm (a) fmzwamwmmwwfiém (n) A fwmwfiww <mmmewmmzhummga mmwwwwwmmwmm (El)! fimwmfiwwmmzuemmw hum—mgmmwengfighnmmg (Q) ‘ _ aggrate'ygmie‘ wwwmmmwmnmaewmm @WMW'W$M$WM(€) _ Iguanaaeawmgmggemmm mmmmmmgmammmmMMsz figamwwm‘wmmfim/Wseam 'mwmmwmwmmwwm wugwwwggmmmwm/wflam A Imp—mega mg'uxgmgmpmamwfiugmwuwz 6L03'W9'Ehmflfimlfighfl-‘AE

3c-c1 Trat/T 3TITMR7 09-1( 6 31th?f, 2019 15

(41c-r) faxciRwew W tcF. 31-14sR4h, 3TarrcrS 30

cwituNI fkzi-or orfrii u.tarr uffer Acir W w-rdah \rq: yrdl

ti-R9Trim- 4*11 ;

(31-ru) tr4eTS 1:1T9t4, trftaTITTIT 3th zrilr ucair aif4-Em

(t) facAtiiew m -114-11k1 6•Z T TkIlTur if 1R1)11 Tr ffitzr

tIkeif;

(wr) Rfwcii W atarrcrff, uipiPicp kr4 avq t4iiiRcrcT

WI MRP14T. 3th 3F-ZITe711 T 31-tith 3T-TTR1F faRzAct uqr scikci

,

(4441X6) faYcliaVIekT Thar f4m a3KIT34, fie4T-1191, i"4 kvf uqr 31R1 mtna) 4Fr-ol I5T ;r4-74 cm-ir MIT faPzlikr

tt*11;

(cu) I ciIe q q W fsfit E.19, 1i-44 fareAcr Tptre

t f41.1-r4- cmth;

(k)) fazcAthem W wrzil t coigAcr cp W Riç arrastrw Entiritt \314,4-circ \i4cmur attR- 3T-q4 Mitfa" TFIRN

ch'01;

( 46) RxciRI E1Ie1T S 30 -4 a (from 14get <froir,

\Ia ti1IiZ1c1 cfr.j att ,<s4 cr),1;

(cr -u) arftriWarr, iiR1q4t aitirra-s4 W 3T-1-4R

-Wcildvid Triem 3t3f *14-Itc1 4-19raI Wr 11Pii111cf uP_IT ararrRff

cm•ir;

Pqr44 945 wrTY4 Trita qj4c1 %-trr

71t/17

(6) cg 9)I tic Th-T 3rT2fEi 6 lf, 31-44 ircfttf

Tredff 6)41 31P-Tcg

([r- ) II 'ATM giir114-1 td dt\LIC*4;

(sr) Nur& gm rI11-1 td 14CotrIcr ftrur 7rRlt;

(A-0 •<1u4 \itmtr wr 7-w 3d41iTtr, I 341-4u Trit4, \Jay 41

wth-r On- 41-c wr 9 A-,

(r.v) ') met 3T-41:4 W r am0 ticartfri

zo wooZbT \rw 31-m7130 yr) TT 31-m14;

(qt) ,<I\rer \-Ncr)K gra 3T-1-4'rlta f$--4 AN) ma- W lrier

Trg

3rm-0 S *ft adt19 F ftrail Tr-44t, f -frW

forktigio wgirra. ftrafr thtWI W cikr writ cr) ,ir;

(u) sei- *Aci 1T-49 *14\1-4 3:11t4 6)41r;

(1-110) Rcri 3TRiwrd Th-1 c01411RuS S cm cli #FT tie

will arar wg *ra9 arRrwff A4ir \i wr

61,tr;

(5) 411 LI tic Th-r

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image14.tif

(“oz—mmumpv) 199m mule-mm v wa‘de’laI swgggg aggghga‘gguugwawgmmmgm hwmgwaMwMMM) MMMMMM fM'MufiwwhumemwMMM WM'MMMMtzwwaa M$MWWMMWMWM@& imamwmmwmmgmg hMmM$MM$MJ§2§EMM ‘ ‘ ahflwgwwM - < MM'MWU‘A'WflEMMkw mew—lmuaawhmwmw waMMMMM ~huateuu£M @MEREQLMLBWBMJQWMQ) IM‘ MMMMMMMMMG} 5m WWEWQWMMWkEW M$MWMHMMM<M) fwafiwmww 'MREMM’MEQAkEWJéEWQELE) \ ELEM-1 Mikaifikflzwléémsiwfiw) TMMMMM MM M'mM$M(M) ' _ ‘ 5M wwmammmwwmmm M'M'mM'MMwM(M) ‘LEME’ MMMMMfimeMme aaafiammeMgaMMm < 5% MammwaetiMme ' ' ‘ 5M MMMMMWM'MaEMMM) film—QM @MmMsamaMMMMQM we M 'W 'M $2 Mm ma) Sl A SLOZ'WBLLWMM

16 \3c-c14 9 xi 3T#W.ITTuT 1\4 , 6 311171, 2019

ccr 411-4Rr

toia 44,

'eat *ark 4914 ar/T

x9 vici 3T1 SITRIWTOT

WO% Thrt90 Ui liOttldf faq

ar-4-dr

• t idx9Rvicio Wit 149nur

(9mr9 mat 014911-891mr 3119%199r 9 5 .1

49 44 td-M4V1 iuiqfr1 10: pj 161: 6)411

c9itiriRtic a WA uzt i faPtua, taM ugfard TRTzil

ug-trd ii Rt,Alq4 :

irg f$ 1*-4-11 941114 M 614i6N 6.1 a ffiTit 4 salt 3,1-409

cHmi cwrrq 3rf44rth 61,a;

26-(1) raw iitiqfPUiId4 ThT l4t_4 icr) f4M171 64t 3t17

I( 991, 3Tarrte 99T1 qPi9I M 3TC411' 3TE119 460' q '1V9kviiciel Me1

/*RFT AtrdtriS tumea 114amurm afr \itKor whir m-#111

(2) qui eic I5J io-f 34TM WI-M474 tT 1:1-41-a 117 371-M1 ikii

3ft7 cqt-41 tO \ila Thfotav1 \TIN'

27-0) 'Rd 4-14?f, f4411:1 4E47l. met t4111TW M fç

R41J 'SWF MM171 MMTZT 6111

(2) Rai •614R WI siorr, 34Ta i1hi4i 3fr ctivel $ 491 'eM

fro 14)ii viRr 1

28-0) 1q1‘31-1 914 facOviet4 451 it4.4 Th4)‘94 ffiMPT 6 4111 9

71U 71r4ItTd 4)491 ft 319-44-991 347 t&ftzi 961i4of vorr-A, 1hclflE1te14

ar-Tam 311rq14 ZIT 3194 f1;41141c17 fflazif M ;04E91 *

(2) Peilvicr w14451 ;Tuff, JS 7r-4-R:et MI Wag% 31)7 3-4Ta eit

3117 cr-1 t-41 ultif 1cM ftr69 lagif vIle-f

29-trcoi4 MR/Re lizr Timft, riteiT *AR 31)7 Rcntrit-14 M 3TR:i

TITRM7E11, jf* 1-11-4Pik 9i4f faxcliavide4 1111 ,94ur 1411do 14)4 v114, 051

t1a-4Si41 6113. ctzcel S ‘,1,a faro th5-4 Aid I

30-44 ere fax9fatilei4 S f4-411 191(94u1 TIT ffl-M171 051 4-14*4

6)4 tr 314 it jiiIiI, iR ag :-

tm aRReT it 31'1 fe711 TRITE •44igicv.1 gr(r yeir ip-zrr Tim t/*r fldt

3f99.-4ef ei (3)9ed-M 31EITM1 ai.cidti Vh41 311:17TET M 4 -tiff cs6soi1 Trzrr

s-1/4d1

it

It-711 SeiT M 44-cricirr #1 31-rd 34M7uT WI

cuiclr aik 3T2T-ar wfi-4 f&RT 61, \i1cr>1 #949 04') S 17 Trr- ff fth-zir rtir

M/Mcf 1141 ?El

c-irf ?TT 3T:f 1IT1it(4d' L1ftaretT111M fir4P4 fclkk1Ic14

ft711 TT 451 icjcb iii

1. zufaciiew tt f4R, 3r514 cufasvicr. fq \itiqncr

<fril/m-Rt

it

31-f'acifasme14 g11IM77 TIT f4MT11 451 c.9)4 f1Iki4, cm TIT

,qi4qi1 3-fr4 crq favf 61.1 zi sawit 4id-r c614 It 6)4 cm ft

eatr4sr

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image15.tif

l6 361? He? W133, 6 W, 2019 mam WW1?! Win? W313. mama, mm, afimmsfiv- Mama? WWW WWafi Wfim (naflfiqfiaqfifiaifiafimnfiwzmwfifiwfifififil ()mqfiqqafifammfififim,wfiaififiwfiufimwfi 25%;me . waggfisfinfiwfiwfifiafifiwfifim$w WWW—61111; 26-(1)fi€nufiwqfifirfamauwugafiafifififimshfism W, WWW$W$WW$WE€I WWEBWWWWWWWWWI whaqfiwammmmfiafiwmfiafivmmfimfi mmfifimfifififiamml 27—(1)fiafifififififiumafimm$m Wafimfifififlfimml (2)fiavfifimm,wafimfifimafivmfifiafifim% WWWI 28—(1)fimmfiéfiwfiammugafifimfimmlfié WWWQSWWWWW, 13321133113111 Wmmmfirfiummfimzfimafiwfil , (2)1fitfim’efiéanm mWfiufimfiafiwmmfiafi mafififiafifimfififififimml 1me mm Wmvfifisfivfimfiam$m W,fi%wfifiufimfiwfimm$ufimwmfifififim,w mmmmwmmfimmml \ 3mfiéwfifi,fiwfiam$fifiifimtfiafiwmfiifimqu fifimammnfiasz— . (1) Wmfimfisfivfiflfifimmmfiwmfifi firmwfir/afinfifil (”W 33 3121 in afifiwmammmzfimfiammw fi/mfig‘n (QWqfimaEWfififihmfiarfiufiajfifimm méfifi-awwfimfifimmfimzfimfiafifimw fi/fimfia‘rl (sammfifi‘fmmwwfiamzsfifimfiwfimfiv mefigfia‘n (6)fiwfimafim,mwmwm.m%$mmm Ianfir/mfin 31—W$mmmmmvafiéfifim,mm .mefiafiéfififififimmmfiafiéifiafiHEWéi Wfifififil l9l_RPH_DaIa 4 Vidhaika Folds! (Adhiniyarn‘2019)

dn-K 11 34-4:11WMT quid, 6 34TriTf, 2016 17

32--%ci1enci4 cm 3IP-It -fttTTIi %it tiqttf tef n 34TM faith

c-€411-4 za• \31 re-R1 \TO- W opof 3I2T6T nTIU, ft* 6 •- ffigtf zu

FRT o11.11

'WO tC itzu iflJTzzr, TT trited7 f i\3ii4 W cow( gd ft-#1- ftrofr

zRzrera \flf wed?' 3P-T6T f4WITI q'r iitto ft-r4u zrr

fWzrr :

Litq Zig VIcla f tMt i I c'a 3P-Tqf Thwrzr •i- T t

T11 14 co14 &gm far 614 trz ffis-ovr zrr rui- A14td arItT, miltror 312T6T

Mwrzi iI5T ticter ccicrr 34-405r ar-d-Rr oco ,a4 i1 itift TeAT9 iTT

ffizrr zrr rtinf*tc ?war zrza

33-114eilci4 TIT 3TMif51t 3TRftTs, 1iRfl iti1, 31E/71-W '11

W41 3T-1-€4 dPIR14I zrr 3tTTrf4-ft Wf 416-f, ikta-frecTi t

Trig, ‘3).91 it SI tif*zil- gNr ViR r -14)g vn4 cua ql)RtdiIIL4l tg

311-4Prt t, Th-T Tr-t-t 1 41- tAra Zff3q(I1IThTAlcs-r will .34 edur

q 6i4 tir f sTrf4-1 zrr 3M tAkr wr co,o)- iiRici,i 1 zu aaret

gN1 -R1 -cf4 f4)411 vilLI I

34-(1W1 3T11fk411 t 349- QTrftM 3P-it Th9 cf tnefvi. e MTR

it chi414Rtfq gNI 4-64 wr-441- to(cok ‘iricor

34-1-41--4-9_ \AA k wr 1))cir wthr

twopr fbcifdvicizr gkrwtccl e Et" APT tftf4wR

w-1-41 30 Tire wRet 41u 4t -di ar-fhlta 051-411 i1 ,<1

'MOH ‘itn cfcf rR9cf tifief lird7 fl41I-4T -4 VITI arizrr- arfitro

wedi t aTero-r Rxcridtheicr tzna' 4-41 w- rdt t .5-fr vw-R

e &ft tiRNfliciell ar-j-itfo w-r41

31Ii1fTTFI t *Tett t altitff ,(6a- -4

r4t if coli f qa Td%RT t/14)cir t 312S-

M facIRVIcig mActro4 \Atir m5 timo-tiiitr IR act -Wm'

wrzr, 051 iiorr ST4t i I tttir 3fr'? crzczr;

(w) \ico-r Wcp•oi W Trcizzil wa r f4rr 30 \a-icot zrq

-49-r .<6•11 dctcl i I t''i met RWril m-r WZT

'(1-4-i4- met far4145T WT viva 30 -39 wRrwR-0-4

Ted 3TR1 Witcl 9I9et ffilZ wcreT q,c4r ‘311-ir alm-sziw

;

(w) fcAvicic.r 3TRIWIRTli it fke4ff, ifarpli 30 cricci uffmer

zrft-d-Rizrt ;

facavicicr altz[Fre atfiz aTR:r tazftrw ut ur

co -.II c.Ait f4Tif4TE atiT *-4 *FRITTI;

() Zif aE 4 wrzto. apw- cre a& 3T-T taTfert ;T

1iu'ikt 041-caciq itt, ii x€tciti i.iPthutir iJST witm )6 f co :<4

fU*4tt araRr W f4-ziftr;

(14) t4ziiR4t e Air 1i9-4 Acn4qccoo g-fifturq, tizr aft

4Itzr Tht, ,4)cif cf ait sivitilictict)

t;

I 91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image16.tif

WWWW,6W,2019 . '17 ___—____________d____——— sz—Wfimm$fififiq®mawfima§mwafifi, WW m—fim.afimfifi$wawma.fimfia€figfim WWW" umfiawwfifiawfimmvfififiwafifigfiammqfifiw WSW: ' WW%W$WMHWW$W$ mfiafiémfififififiwfigfimmfifiwfifi,fimm Wammmmmfimwmmwwas figfimamfififimwm ‘ '- 33—W$mfimmafimfi,qfifiafi,m whfiufiifiWWvfiWmmafifimm,®fiém—fimfiafi m,fiwffiififiafififimfimfifimwfimfifififiam%§ Wammzflmmmmmmwwmm afisfifiwfiimfimwmmmaflfiafimmm 344nwatfizfiwzfimfiwmfifimmfiafiwfiamfiafium qfifimmfim‘ WW gm m finfifi at}? W W W m .qu‘lzfififiafiégmgfifimfirfiml (amfiwfimHmmfifiafimgqufiWwfiafl WWWW$WQWW$WWWIW§W Wmmfiafiw$mmfimmafimfifi afimz‘mfimfimafimfififimififiwmfi afirrmqfifianmfifiafififimml (3)wmfiw$m$mfiagqqfifiwmfifififimfi wm‘wmmmmmé/mwmmm- (Emmanzfimfimfimfifiwféiw—mwnfififim m,mnafiafiafivrfififiafiva§u; . «mammwvfifimvfiafifigfifiafivmwm meafiqfiwfi$mafifimifirwl m,mvfifififiafiimwmafivmmfiwfifi mew,fifl$mmfimmww Wfififéfiwfizfifimfigfifi; ' (mmfiamaaTfiwwwgmmmmmm www.mfirfifimwfilafifififafivmwmfi W22; l9l_RPH_Da|a 4 Vidhaika Folder (Adhiniyam_2019)

18 L1t3T 313i1EI11Er1 , 6 3171-ef, 2019

(g) cr) i)ir tt ve)bictr -s-rrtho- ctn.)- caa

faqifavida 4,4-caRilE zrr iiif itzr Rara-i fkrokui

M -altar; •

(g) R1wdl * f &Rat a' sr crr-Rwriit

F4T-4' co4-rma VI 811 gkr øi4 arm $ Trau sittr cir<4 Mvitar;

(7) 9r9-4 \iv! wr liqif Rqr v11-11;

(Z) qilt fti cuTrur—tra S Rut Tizr-4't 14

014t1 .

(U) 311r-1tti., Er4-0 a-ch-fil

if0•Ta cht-11; ••

urt$ 9}zr argrftr9 vair;

fakifacacii $ trftfR $ ti Rautt,

34-04134 atiffi- l WITTRI c4, -11. 3T17 \.3•14;) *Kid <Nil;

facifazacii varwrftzil zrr &Raft-al 4 fed - 114-d4

p) zit cfr zarRzr9 t arj--taz faro

..aiurr-kw ik sTrwr

(4) 411 14 tic li11wei4 S .r$7111 1447.01 Thaf Y11.4vitil ZIT WS lcii 4* aarfd--d crn4 cueir cr)) 14PPi99 ffi 61-114 411 S 9t th94 TWIN

zrr Ry-tm CRP tt wRiwzur u3?-r1ad- ffifk-d WI -

wzr cicto 451 3t4TR 9 fair uito STfr Raz and- a -at WI- TzT cni4 tiRig un-r Rarz fir 7-r4-zrr

35 31Riftli StIRE*144 31TCett 314.19. •<6 4)1 .1•14 -P4-- 1iRgd- -14,t11- Raw $

utra-ea 31altq

f4i1èiel4 bi-)tt a Ow STfl wur \51cnt thflicorr;

qzifavicia zit

tucliasf Rttrffi -R>ir

(9) 914-m S 1ST a trram;

(Er) wTritrzti, 2Leilerr, wifiliT—rfq UeTT *iPit I ql W4Tff cM-I( 30 394 atter METI-ftu cfroir yam falel kyir.)

vit4 $ TriRcia ffist uii4 it(4 1/43La ;

(z) fazgratacia 4 31U1z49 Lug so wan attaTrail u

dqIRldt itt4*9raff S wara-r—Wr ATTRi wr REtzur;

(w) arRas-rWthert, 1fl,ICr14i. favyautr, trawl S 144irr cm4 s-r4;

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image17.tif

(sloz'wfiwmpv) Rpm mummm v “PG—Hal—lél 32222222221222 wwm'm'mm'wmwm) fmwwafimfiemh—mwm'mw 22222222222221‘22222‘2222222222122122w2)‘ fmmwmymmRMM mmwwwmwwmmwww MMWW2m22h—w‘wmm2w fwflmhhu‘emmmn) ‘fmmsgggmm‘gm ., M2mh-Mwmm'mmwg2mwmm) ' fwwktfifimemmmgmmmw ‘ -2;22'2222222@122b2m- 22222222222222222221222222212222122222222 2222 Whfiwm2w2wwWAE—SE 22222222 Immmmhwnmm mmmwmmfiwmmhmawmmg 2222;222222222122222222212222222222222222 {22222222222222222222222222212222222222222 mmwwmww2mm2wm( Irma mwmém$waswmwm® _ . {419me = 2W2222me2mmmmm) -‘L2r22212222222uu22212mwwmm22 ERWM'MW$W$W(2) ‘122221222212222222LEI2(2) .mmaga 222222222222222222222222222w2 ‘ ' mama WmmwwwmmwQ) ‘ immmwmflmas) fwwzmw 22222222222222222222222222222 .222222122212212212222222221222222) 22221222 222222222222222222222222222) Mmmwwmgamwmwmmm GLOZ'WQ'MWMM

z 31311ETRui , 6 3111i?1, 2019 19

(g) Otarrat wr 31-71-ff urfte9 -ffi-wrzh, 31N-

3471t9WfWr 9-4-rat3M ffiziffivrfl 3M m-4-0:14tt;

(7) facifasnekf M iii M ffi-a-re met sicl; (w) untaft M ffi-art, afgrftr9 aM 3TEZITEF \3114

mtr fazla aramr#, coli ft atly fo-c facifavierel W arwrfa favltr 316TIZR ftr6d cM-11;

(51) t4niRIf; f79M Rw iRffiwit UnT ftm Trzrr

ftr9 s4tuftth met ffisfavr 3M 9-ftMITErr;

(z) 31u1R19 3itz1zr9 fl, 3T -dtttzr 31E2RF, faftrtz

faittz 9-919s#7-rail iwrcrw;

(a) 3TR:r favafavicitil atIR- iiActkun't ft-frM 3T-4Tra allcH-11

zrr W TrozOr Treer-dr met W;

(z) 144. it 3T- r ffimrzr itt Thafasileiti W -term

TTR W 1i arrarm tp*ir \AK 451Ti319, utmet tkciir 3M it!

co.N;

(a) 91tar4*, auttrrmI, 3T-- ter4* aMtipoilzicoi Tra-r9 fa)

cll 11-1ffilltM;

(up 3TalTcr4 atIR- 3T-1 term sii-ciiRlq met tar met

ffi-a-,c19 91:3ft9t gkr Mita- tt

36-(1)fauf1vici4 4t qrfiim 1:31#8 cold tiRtiq ffi-ku sitft9 Aziw qiNt

WI aft P.Tr \34 fa-Arma atir 141ta fakir uila, vrrift ffiwrzr rep

lbir 4r#Trr 3M lI ffim-Rr an4t gag) tam It REIV trz famN

co 4ir ;

u1tMM-F4ai1 t ft11.1.8tg 311:14i fèuiPiii cpj4 ITRIEK 331-$ famR-Rf 917ffl a)411

37-(1)faZcIlithel4 451 0T1it$ *Ulf 3N wier-tm, std urftwq W ffit411

$ 31th9 AZIR fa)4 771-4 afN e),Nr-traqtaTr, qjçf -c11&4 )1\1•-d

&TT-a arg wri v-r-m wEt # t m-9 ym w7, 31*W 1:1 -g. Trru 31-Vra. m7R11 7-MI I

(2) atql-tritir 13#18 wita w14m/c)(gr3ll met ct4 9ft9-4-

traull W trzr vult ffim-rzr aftR- aiciA414/31tzrat 4--1 ;Fp tl wr#TftI •

ctrALIR/3It2rei w1 clifaco at11311 fa)a- Irt (14 e-TTIT, Wrift

frt-RI 3117 anzf #ThEr-q- wrer4 ativ tifa 4)14 q tid ti (44 9k1 mtaaTur ffi5t it4 $ Warn ‘14 arrift-Or/sitzreT Wr v-47

fakir 71t9r azu flIcivAct) OW faeir 7rawr

38-(1) faVel1411(14 oir SOr$ ct4t4l wr 3TRiftarr 3M a-cc119 c1,11

Tit LIR1z144 Wiet ffiziwr fakir 7r#9r/coi# tj evik.ir

wr#Tir

skuiReif Th`t r lhf

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image18.tif

6] 931% gamma 'mamm m’m (sloz'umfiwmpv) “PM wwpm v ”lea—delél Imam mthflz/flzmmmmmv$®m$mah wwwwfiwwmmum Imm&wwmmml wwwm/W&M$mmwwmmm zh'Lawan'unaquwawkm-aaanwmwm w‘mamwmhhuemwmam/Wa) . ImwmwfimR/mewwmaewfi :42 Ahab 91% new Lac ume/eeym 2% gum men-me (a) . .IWMMJEM gammwmmwahmnmmwamww QMwm'mw—mwwmmmwg maewm‘Eh-hafiwmwmmmum V Iwmramw _M¥EMMWW&WWMM@ ”my. Ammamahmwmwmwwmm amléemsaawmmmfiewmwwmwme mm¢m$wmmmwwflm Ikahaawmmghm'yswmw' wmwmwwsawgmwmw A fwumauzwa MMLQMMRWMW'W'W® _ mi ywm$mmwmmwmtBMM® mwwmwwmsaémmmw. swap—1m mate $2M yak—mm we mam; rate (2) fmwwmwwm' "Mm‘WWELEW'MWQY imamwwfigwmmw @‘emmmywmmfwmw imgggjgihgzmhhmemg Wanmwmmww‘gwan'mmmw wwmgzmmzuem‘w¢wm(fi) figmemmgawszmmgm) fwwwwfiwfiwwwww wwwwewmwmmammw(m SLOZ'WQ'MWMIEEE

3111- co

afftrwR

m--4-4rtr ffitr arlv Tit

xa €41 3TPOW1

311745Pera o0Y

Thrt 41fa

20 3c-c-N• 1I1 3TRTWIRLIT IuI, 6 WIRE, 2019

fcdRE.lIei4 3tWI. fR1Ci 4EIT1I M 9ZJ 'ioT clicli9)‘1

1=4-4R 03cI1IRI faZ ft-tir slNI4Ii, ffi-aTi M et Rift ft-a A

M Itrd• 31-9WR 1AUIcr,o4 W Erswo; fkrq trR qPx-cyr

3T-ieudt WTI t IfT Wq-,t 3TT-TT7 TR TIT 30TMTrom zET 31Teim 3TRTR

wrd-Ru 1M-4111 <Dila W 3Tizr-,4 fm-di faarq met 35--4- 4 30 \to 1:fq

'1tr qP-94, MT61:11t 9H1 fMiTT MliFTT

39-(1)014 arRro- ZTfc1 f11EJIeuT W fmti aritmit zur tuRrwrt W

-Witt qfx-cizr W f4-w4- arcit qPx-cw mcr wrikr W ft9-rw (Ti-r 916 met

3T4f4 .MITEd7, ScA914/3TEzie-T m'f MT7 •419)01 t :

zr-g fW mca-ercrIt/3itziaT W gni fdwRI W ?)- *-4 met

wffivr tit, a 3,601 ZTflTTFT it clit f$ WWI ci uitf

fic-r ow/ iltd7 am* S wq +km Qui

(2) -@11 telAir14/3itzrai wi Tana Trzu 4)14 f11 1 xii

artdiT

aci-qvcrWriew auT4 mktriNi met AtitTT ,F114 t

zicif W 3T1r9. •t64 F u)tif iM colei Trforq gir fdf)nrcr fMir \ma, \

z1T chetnulchi41- 91\31-041 zIT giftlsti fkM MT +Id.-1 (t) ,61 ziT 1T414ir

z4w-91311- <0.11, ulor wr'4 3Trr-1

rwift iItia u iMr mar FMTitf ttk 3Tra,

TF9T,4Cflg ticnor zrr arT 4,h-1Iauf, fav4Eriegr autrP4 it, lt

iR cgcloRcr gro WiiPicf -14)tir Trzrr 4, 31*-4-9, 3:09T, an-kW,

chi 9i , t40e'1 zIT 4tthavf m'r zrr salt met fawillor cr2m itz;zrr

Tuezr W 1 4,16.111Mzu 70-Trr 30 3o4 3TRfara- q94 ilo-16•< r

wEr 3Trezr W jtier ra)a 7[4.-4 .161 .4 ?a ter TEE gR7- f4)

3116-71. 416u1 61a I

M 3Itik 9-114 *1. TARP911, 3It4TOT TIT TWPTI:f

facr cuotr .gkrutt fmtl -rzliii

wit 4341) ThmTzf tf7151J 5 (114 ctra.5 „1 /4,94 * \IT ..PAT-dt

fer fAtr wrRrff m Tftr

(2) .(wzft ftRTRT f'4r MT ugaTT, miftra q-971P4T TLE qfg

riftgd cm4 M f4 frr -rz)Trr 1'M f. cif4rida I arRifizrrr ucrnt ThT

31@Erra9 t uan **r 3TRA-ag, 14RPI4I 74 a/ante( ucr-4-4tt

37T1R 014 Th7 7-6T ti qYc1f1VAlel4 3T2T-41. 11141)u-lch .1M-TET gii tt 3TRifkmi,

'iR1i4i, 31tzfrke zIT WT4EIR eirri4 Trt faIi4f W dgetf I5T 3cTit4-1 <m4 WI

qw \yer ,twok W TrkT fwcfr ?It M fttit omkul msr

ti'1qcf cm met ifax-I ffiftff 6)41

(3) woo itcfr -1)R 34 6.1 ic.1I 31.17 M"3-LrePT faxcrfkiwzr

W 34TO-4-4913U fawr-fr tg 31aTTOT faci14irer4 au-d-tm urtr a TO cj my

*1001,1

19I_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)

image19.tif

§o~|=i..=_€<w 20m 5:2; « 2512x40— . .mE . . EEEwfiEEmEEEEEwEfi . . EEEEngEEEAg _ . _ .3Eafiwfifiwg figggggfiflflgflgwégrcfi, fiEEEfiEmWEEEWfiEEEaaB .EEEEEEEEEéEKwEE wEwEaEEQDEEEEMEEE EEMWEEEEéEEEfiEEg a; E w E E EE 5 at E..E,_.A~v _EEE£E ea Egfigwfiwfigmwfiggfigfificlv EE EEEEEEEMEEEE gags £5E.E%E€E%§E%afié fig. _%E¢E$EE$ Egérgfiaimsfifisfirfifizfirfi %E%E§E%EE.EaEwaE EEEfiEaEEEESE~E. _E_EEEMEEEEEEEEEEE% E p: fi_muEEwEEEE.EEE5E_E_E @EEE” EEvEEfiEEEszEfi gEfiE \ _ _EE»+%E¢.EEEE EfisggggésEEsg EEE.EEEE&E%E£%HEE.EEE Vfiwgfifiefigfigfifisgfié gag. .. . Eggs Egfigfis§\gflfia§gfis Egfifiwwfimggw‘EE Ewgfigmamfisfifiaéfigawfifiw fifiEEwEEww§\%&EE “mgfifim§\a&§.§wa§ 5 fiEEEEfigfiflfiflmflBmflBwfiwSlg Eggs EBB EEEEwEEEfiEngEg @firflfigggggégwmafig HE Vwfifiswfigfififiwfifigvfigfis vaNKEerPFEk/LEEE , om

k.iccrq Titta 31-f1W-TRTIT We, 6 3.111-i, 2019 21

Ia.-iiei VuIit ettET-43Tftr 4 \Al irt fs ft<cnk gkr fro 4)7, 4 ffiffiiiiiu 4 aft at131cOvricier 1dEr-e9

(up f4-1*-fl v.41 afr 41t ara t1 eolith 4 faurff lii vii•1/2 S1-119a 413

,<1,1 S 41.4uct) wrr Ad- 4 arm wrrr 14)4 A1-1 /2 919 uvrl Tizr vr4 31PT %if witTrr fs Thief \'-ktlq a 14 ar-vT t Rrir \iocr ET93-rftrml 3TTUDT 711 TrztriT fsTrr wilt!

44-(1) faxcitawqw .srs twri-zr Th-Rr 3:P_Trierff <0411, I3l fTh-faRgo ET-43-rft u1fli S uiRi4l Tg-TiTd

(T) *I1itcf i #t fklP1EJIel4 gkr 3-47Trfta 1-4)4 wr 3T-s* ; •

1*413T-421 31/2 iitc-r wityr ET-qu1t-4f; (Tr) timio gkr 14,4 Trir air4T-4T9; 31'1-3

(ET) it* arr ci r ffi-srt ift ortp-vr fst aTR:r ffiNI gkr ed-firq f,gra Tfr ffiftr f4)4 Tr* 3:rt arta-cm ;

(2) *11411-0 Mit4 v19f Th-T 31:147T, qYcliatlIcl 3Tra (2141 1f4 Th f?)- fSTrr arr

45—(1) facrikrierzr IN) MTIff PR 1- e-TTferd. cr) I 4fit 1RsciEmTrftr wTrr 5 7p!rtft, aw_Tfq

• (T) itsre b)iii 31/2 ;red It* 3T-sk t ; • (u) RviPtriew S 1sr3T* v41q-91* -1g ar- r to): 31 /2 WTI

4 Trzft tifltcr ET-43TNT; •

(Tr) rurlutcr) fThs-gr UTRT fa>4 Tr4 aivr-4T-4; (Er) fst 3MT wfdfr TIT if4-stzli,t onyier uqcr fSt fa. wq

;O1 tr, gkr Tfr iThAftr& fa,e) TR) 31 /2t aivr-4-m; at13 (U) WTT4t 113/4- R3 t 9TTE witcr armi

(2) 1't'T31 /2 far 4 \II-HT—ell-14 IN WIT 4 /it tT97Tit TT 3t4tTT T 1ct'r3T*4 fsTrr arr

46-0. 3T1Iftz11 T 310T9. viliefff *141 fat chi4 ITRIEfq T 1141ur aft f)4-mur arart9 Tien Rffcl RI31/2 faffkr 31'1 /27 3T-Otra aft

47-1YcIDE1R-14, Thw-1 tkchk. 3TQT4T .404 1-Nct)K T .T4TPITfflarff at13 ThTtwurrEfn fst wzi ftsni aTers fkir4 31/2 f4n11 *16140114H arawr 1*-4t4 twieror TrN &FIII

48-‘941ti 114vIrlt tNt4-11. Th-T fa1**44 chiti tiRtr< g Rr WtT1T 1-N1 zrgItY qxcifatrisier, .,<To-er tr<cw Thwitg far arEfR arearff aTers fazwicr) 1 -sr4i- TRH Thrcr !set t as •'zj• aTcr4 t mrtfta cr)4ir 31)3 .iricivAco wq 4 ,< wilt I

*II'1V4 ft

crio ft

ffitrzri iiarrTur

xci1'I4E1IeU4

toracci

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image20.tif

Wmmannnsssm,2o19 21 (4)1awrmfi1aafianafirafiafimfimfiimw fianmsfimfifisafifififiarfisafimafiafisafiamaifiasn sasfilfiarfim‘fléisnatfil (5)aiaaafaafiafinfinfifiam%asfiainmafiafin mafiaarianmaiaafismawfifirfisrmwmwnaimnfifi wwaszfisrafirmsramfismmmzfiigaafifiraifimsas Wammsaainnflfirarml 44—(1)fiaafia1aaamsmmfifamfiam,mfifimfirfias mm‘» marmafisrarfisraiaz— (35) W {IRE sh fisafi’araa Erin mafia ram an W‘s“,- V ' (mfisfisrsraiaiaiamsmsanafirai; (mmmmwmmmmm . (WWWarfisarfitfirafsfiafirnaaqfifirmm Wamafifiansidmssfifiamnawfim (ammrismransfiransnainfasafiamaaiwfianafi mmgaammamm 45—(1)fisafiaisawfimfifatfiwfismmfimfifi WWWfiW.HfliT—L— ' -(m)fizfimagfifi,shmafisanrfisfiramsaii%; w>mmm$m$mm$mmmam 'aéinaiamsannfir; (mm-(mammamwmmm; (wramimmfisarfiariaiaismnnaqsfiflfififam Wanamasfifafifirannwfimmwfin (s)wrzfifinrmfifiaiamsnfi3rral (2)1amfi1afiana—anaanmfinthannfaansaain fisafiamaaifimaimfirarsrmll 4&3ssrfafianaisr2finmfiswfififaaimafiazaism WWW” aaaanafinfiaanaiarwmnaarfifiséifisfifiafisafinafigfimfi smiflil 7 47—m,mwmmma§wfimmnmmmm WWmfimammnWWmm fififinmzfifiaafinfizfinr 48—W9aitfiniaifivlagfi5sfimanfifnaaaaflaafiaam as” WWmas%fiwfim,mWa§fifififianmfifaai marafirsaaarfifiamzfifiamfismamfiaswsamw mwamafimafiqwmmmam mm l9l_RPH_Data 4 Vidhaika Folder 1Adhiniyam_2019)

22 N3ccNI SthI 31-ffTETRui fluiC 6 31#3ff, 2019

49—t12711 ATt4T 614Zh ti1T citil The1. an%

'Vita 41eqicfri sr-rrz19 latic UclIM T1T 31. f 1•!chN

911 194-194 tR 1'4'o f-z`r ,3114, wid cr,44if Iqg 31- 1 RitiPiet)

iit RxciWild4 ti6ui 1hT 'it Inclqmitt tt ward t

AILTE cOiif I q6. it?)- TP) 3TRFei

osu i-kok mi qjffl ctiri fieCT-611 i1414-1110 'ER. 4-#

.jC Ct)0[ tit-4d. 4141111

50-\31411W, tv1 41I 14cv1 TIT it-fit 3TRI liq)uirf ffiff faf)e-Pii,

3ItzlTket ?NT qN4ii gio TRU R11ciqlfff. ;r-rw TfTZT5 4 foraEricia

wiTrzfig Th-1 far wrir9r

5141) T 3a11#71# 3 ff-4q1-9. Aat #3/4 MT faRi4f

jy*ìf 451 31-j#Ta-ff iSraffff cm4 c.cv \istr Mew 91'019,

4 set 3014-R.# 6)411

f41 VI el . ftc#9. 1-66,#0,41 .Atd 1311->11 3TRIA.€1.,

tuiiq at1z 9-41err tif-Aci 9 614 crie1 arROwr, \3ccp( 9-aw .3,74

Mall tiRqs051 99-g-6J 4zr9 ur-91 Wr 31%9 wErrRr \Jay- yew \I-L=4

wr L4Rt4q W ugat 3ir991I 9111i1 141,d,crr<4 oic4 i1ith W

WIT-kg M 31. 30 .14-1 11.ff jcçlAaYI \t“.{ Itair trftER Zm

Vi7 fan4 3tt 1IRq4 \34cr t1 451 3r-I-y1re49 w-41ti =rfa 20 R-1 M

td7 tfffER 31T1)-4-9. tt titoir Rardcitcier w-1 41 t a 1,

39.itiftUm .14t w9611wr9eili

'Jccl' srtw ivti \int IThir 1-1 t14., IYclikficizi

far& crtOwrt 3rarar Sit èfxifatrielit zwzrI349 fwzli 3199r TIT

afird-44 Thsf f414fatt ft-9[w 74 tiflo 9r9z 99-69r cmi4 f. 4 476 ticror

f44)F 614 urz \icrpr 99-ca Ir4 \ittr ftrair 9139-9, wrjr99 4,14,1161 tg

fluer tHcok f4ti18 4.19a 47 W-t—dt ti

(4) ki Ca.( 'Tata 'thief ktvri ft-TT tiRtic T 3#4Th.#.11 \34614

ar@trr cm4 3t1z triarthri ft6TI A-419 <frog iltiftqw <fro1 W w4lw-40 wE

arfte499 W 349 W-Terd faxcAvieigI wr ZFRt wPr kw a 1911wor wt91

qniatd W:1 t-f1 31treff## gRl. 3 31.th

3T-Tfrg# TIRE-4-1. arcrt clif4t faur•ftL98 *Ncr,K mM sTzwd w4711- 1

52-(I)qYcl1klicl1 31.21-41 faY9W.11c14* RA at TIT 3TRIWt1 On

71U Wtaf OM ft W 'DYc1tlic14 AVIRTff arerw Rcri wwrr attz 3rr

TrrTra't zrr i1itviiql arrft t Tread- ‘199-rmg 3f4Mg# mM AR?Sa. (0. atif ft

M;t1 litzPV1 urfr Th-lr mci vilo

(2) zift mkt *Novi. Th-T Z13. ?Ont ft 311.124ZPi, .141 31ta-kta

Trf Uctit9 1.11 a Tit \ievit44 gaff t wg arRe499 W 3m119

qxcifelier9mM 4-4 fk-kw .A14ZIW wat t .1* 9g 311-447a 194 3N

qxcifavicier ffitTfitd 1414 4-d7 t fkka wr 31-19179 co41i1i

414rII4EieW 5T LIN etti

wcrrtu

‘icci fORTT

.r1 fit Suf 6

afferkat mar Tifrr

elea 411014 The

sfaridt

19I_RPH_Data 4 Vidltaika Folder (Adleniyam_2019)

image21.tif

3.24:3...53 52.: 5:35 .. 554..wa _EE§§fiEfi§wEEEE ngEEfifiEMEEEwEEEEE wfiswgfifiemigfimfigfiefiwfigs E.§.§&%EEEEE%A~V .. _E%EWEMEE @gfiéfifigfigfigwagfigsfig gggggéfigfififimgg 5E5EE$E.§E§EQYNW _EE§EEEE§€EWFE%E figfiwéwmgfigfiwggé EEEEEEE¢EEEEE§fiE§ figfigggrgggggé‘ .E.§E$EKEEEEEE3 . fiEKwEuEfiEE EE§.EEEEEEE%EEM Egggggfififiwfiéggfig QEEEE.EEEEEE@ _§EEE%EE @Emfisfififipfimfififigfigwég wraaawgfiwpgmsfifiwfimééfisgmg fiEEE‘EEmfiEswEwEEfiE wEaEEEEéemfiwgwwMEng EEEEEEEEEEEEfiEuE. .EEE.§%EE%WEWE%E Eggwfimwfiafigwfiafigfis _EEWMF .gauEéEmgawwgwEbmmfificwaflwwsEmsEE WEEEMUNEEWEVFEEEEKCIW EEEEEEEEfifi Erfifiefiwgwgmflflfiwggflfiwé ..EWEEE%WEEEEEEE.EAW . _E§w§ EE§EEIEERE_EWE#%EEW Efig€EE€EE_EEE\E cpwfipflgwgwrggggfiefiflfi EEgg%_EE.EEmflflEEIEEM EE.E§§EEEEE.BE§ .Eflflgflgwfi,%fifiufiwfir§fifiwfi$ 28 FE» .m BEBE Ewfim

‘3cck Elta 3i1fsT177 ilvid, 6 347-i?1, 2019 23

53—(1) i1 faciNvAlem 3nT4 4 iorr .2TTRO cM4 ciieIT

fa* sr-gin arcr4 Riei 45T 11tc114 cmor t ,<Ivtr iv.cnk i51 ar

. <t) faitff 9srfe-fr aiir

(2) 3ETURT (1) # ffiNEZ *al. Thal Aft. ER 'flutf i-NOK f 1 1Id4

Thineff 14f4 k 3t1 q"4 ccb facilawaLr qif4d 'fart

-r.f apT4 14104-1I ti zo cr)t)- favoratirazi 11

wiltiPco ursTrq sir 1-ar 1* fetu itzrr "1141

5441) 3ifefffili# Mel" WU 53 31419 f- YcIRElle1e-f arlqlPti Th#

4,10,r cm4 sd•-r fax4view -soim•-r* fat &HI zkfa wart f4RTR1

f4R, .919ir4 f4lr 30 ?Oaf ffitr trtt UII41

(2) ea 0,4- 3-ERTRT (1) # flf& f4-Ryfr,i- ctRulazr

• ativ alqINI IRT ur<4 fa?)- =raft ffi Ir4 'WOK gld

ttr ar urg favol&ilatr tp-Likrie41- u2Tr 3rr13S a 14*k-1Ni-if

Trt---dt t

55-(1) mro ‘i-Ncni Tig Wend 6101 t 1* IP11ie14 # *tf

31t11###, NRPW-1), mi,èii zrr 70t9. c4-114 qPepilt iwr \itActu Th—E

\ftreitirr Itirr t ?Tr *tr 3rltif4zrq sizit9 3-4:r* gm 1/4,01 fct Th-a-cir

\3eati-1 sitzrt t ?Tr ETRT 3 S 3111.9. •Siqcc-1 fig11Pcid cN4

Ara7a 1TTIT t TIT ThtlzIst TT 04d ZIT sf4Nlii zIT Tiqi17 -s-t-wtrrr 1=$z1T

\ic-cpr ;thr \ivcr far tre ;rr*rT AT4 tiriAcr

cly<4 .ma t

uprzTRT (1) S aS ffitd MterR faVcatIleief tt 414 -13E48

mta v114 ER, 11 mi4 ivcw 5T ru Trimuff f$ ;NIT itz-zrr

a1Rre4qTr zfr ff-O'R .4414.)- 1-01)w-r1 zrr aTarthil zrr tfrlicl ?Tr

wcro--41 I5T deatm 31T t trr T 3rff4TPT t 35 Ara

Ma. pH. t zfT UM 3 349. li<cki crcilEicgOl faniikd

Ther t f4ferth cOge zir if4ftTitiT zir it4t Tt-trthlT

cm4 45J 3tItc4T 4l \Atli ff1 3Ic1lS TITS!

WIT-171 (2) 31411-9. ulitt fa3/4, tNchl ,

31tiri ki \icrls( 14aYr ,<Ivq4 ntl %LT LIRtK#r thiniPzi icH

149)Pa 1*-41 Zart-11 zrr 3:Aft aitr4zrgr wTOT1

t 3art-2-Tt Mel Ai-cr <m4 fa4, fqzjafr ws-41- 1

WIT-1TT (3) 301# 1#Zri Skf- Th# *tf 3aff#ZFf

*aizih arizr w-4 0T tivi<4 ctr<4 tonr f3TraR 9fth-zrr TrIt-dr, 1908 3ittk

fth-fft mwr, N3itecr: Th,--ARNcr qtioir

,• dincr ifavie/t 0.11, amtg :-

(T) fsift Trret ffi wirr <mir aft7 ucrRP-Tff 04 ATM

cM YrcraT \telchl Eiiirf air;

4ttilauf 44,1(fror aM Wi7 ctr4 31-4rr

cMlf;

0 ell el 13/4E79.

1-0Y010e0(14 ouu

'<kat twoK faxcifaciiegl 51 wR-frgrrcr9

(TO

tide14 t itt At *TAW Tir 3141 11 Met Tur

ctrelf;

(IT) vrtru tFI ER TITO 1411(1 cr,<-tr; aN

() cr>1 31- 1 91901 1-,4 ?to- if \31141

19I_RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

image22.tif

WWWW,6W, 2019 23 53—(1)Hfimfiwafimmmafimfi‘mm W W WaEWamfifiwwmmfifiaEWWafimfi W wwfifififiaaafifivéml ' - IWWWW%WHWWI . ~ 5H1)Wafim53$mefififieafiam$éwfifiafi W$€Nfi WW$WW$W$WW$Q§TWW WW .W,Wfifiafivfifimfififiafifirfi1fil ‘ (2)afiwm$fiwww(1)fififififimfifimfiam $mefivé¢mfifiiafiwmfia§fifiqfififiamwwm WWE‘I _ ' 55—(1)»ufiwmwafiagufififim%fiiffiwfimfwfiw WWW Wqfifivfiawéfifimfiiefifimfifififififimfimam WWW Wfimémwafifim$ mafiamamwfifififififiaw Wfimémmsifimmfififimafifimfifim fimfiwémfimfimmmgfifimflmwmfifim wamfiwmmmmmwmfiam Wa§mfi7¥wmafiméi . (2)wum(1)$amfifififlfifi%¥1‘wfisafi€rmafifimfimé WETWW.WWW$IEEW€IW%DW§WW Wmaqefifimnfiwfifiwfimmmfimfiafiwm WWW_W§3U§UI§HW$WWWW Wmafiwgm§mwazfimmmmfiaafi fiwfiémfimfimmmgfifimfimwmfimwfi fifififimmfimméfifiwfiia‘smml (3)m(2)$mwmfimm$m,wm, -W§mwmmmfimmafimwm, mafimfifififimmafififisfimfiwzfim$ W$Wafimwfiifim,figafiml ‘ '(4)m(3)$mfigfimmummafiwmfim $WWWWWWWWWW,1906$W Wammfifirlzfirfiwfivrliafimfi,fiaflwa§fimfififim afim‘afifi'flffifiaflfi :— (flmmafiwmsfivwfiwfifi$mm mafiwafimmmfim mfiRfiWafiWmafivwmfiafimm m,- (mmmmammammammmafiw m; (H)¥N9JWT\’WRIWW;3TN. (@mefifififiafimfiml l9l_RPHADa!a 4 Vidhaika Folder (Adhiniyam_2019)

24 SEkVT 31-411T4RuT 1h,IC, 6 37TRTI, 2019

.e1.10K .$1 411TrItiict)

nta Thc.1 wirer

f4Ereq / 411-4o1 .<q4' 6 CR

a-151%.11 Th't ;ffRvrtt

Arcr 91-8 ui yr-- tkchk wr IS tTnIITA vtitr f$

facrfavicitr *.tr 3TRAtIli t ftti \396144 tT ic-eitirr fir t Uv•IT ciçIPlcd

3itITTrort tiki1 S 31raFITMt, 7FTI- tk4V 1a114td tp-Kr W

*ti 3rRinifF 5 \i'AEMIT alrIcll c"4 fk 3TRV45 mz cN4 t Pai Rxcifasireitr S 4411 iR facavAiaa W- fbd \pia S Pi Z151

ar-lcrraA cN4 Rtteei•6cir t ti Iv4 'WOW, faVc11411(14 StRk fk-a-zr utpa-

cm,) 14.-s6 f4A 31411 t tw auszvt w_rw 'zrr \3yiet1k1 1 lq

Th-avr Trwer t;

3TRIRT (3) t 3IdTff ffitrOf urITI 3TRItT11 31tIM jiitr 3*Tr9 t

itz#8S ;rrftr -Eft I1 ivtr tP<SP1 5Tzig 311TRITff er ART ft fasfavie-rtr A *tr arRrfAAA ?Tr nrt amitA srila TP4 zrr ararre-vrl zrr faPerfli tIft amm Wit uursiTmi atisivr fwzrr t arawr -1zr4ovr 3-qt-TRT (5) t aerA

Ttke Si st 3I1in7TIT 31.419 gls11 1/4TIA ftl:1 TRT ft# fra-zr \Rvelkirf ftqf 3RT4T viRT 3 t 34-9 3-frt gNF I 4141 cralscgiraft

Niarr ct>4 t SIc1 I TPA t ?Jr facifavierzr ffitzli wr Otid TIT iffeq-eRr zrr TEITrq i-t-crzOr itar TRIT m. firtf qVcatIleRT StaTrIrt 411,10 zR \11.4)d \JO-1—r Trzrrffi tv4 *I.1471,1 TaVcIfklle14 \i9vf araRr faxsfacriew flitcperiql Sti-s&cr <m4 q .R\Lis4zr aciPii Tifitt fAzis w3Tfti

(7t) 3TRTNT (6) t 3101-9. Pictci 31-31 tf#MZF1 isfatricitr

ilooly. S mr cict) 14xiifticr cm4 ifaiert Mi 7-4 do ft TherPi Liigerct)91: S iiI ZN aifiTr 4-4 aFrAr irigercog tit Att w7 air t ai w-fr b/1,11 ir /Kr fterlt ftftzrt, %tam zur *offii 11q1-1 ZW t ;

(t) PqPi Ingerm9I t iif S 31faTE tf Tiqi RUM. ,Wa, f3Lcilflr 74 Ttcw, -sr-sTA ZfF Re)- .114 t 3r--e49 3,r11 rth 1 ,s4 tumvt S 0-r arrtzrzr -ftcnt -sr-4Tr w@ft,

(thh) 3TRTIVT (7) (t) TttliS ;a% TR, mro *NcoN, wi-Aer quit A &RR:FT fasfacnau S ThEreA WE rata '4141 mtrfr

-,41 3aRT9r ucparcr fti5t ii4 t fs-Art t faxcAvicitr quferr TrrAr 3lI1Il 30 -IciDvAicie4 S s'rEraiIThii 74 alcipq4i \icrvr fs-Arw twjluicp ffiwRr t ffiftu qT44t

3TItTIRT (6) t 31419 ;1-0)--t 3aTT9T, '<NO raTTff 91,5ef

3T-4-91 tTreT ft_41 stilt

56-oi4 i-ks7K t1114-4-1+14 tR. Ycl tf tt falsRit ffitzr s• ww-di t, arRrfkamS jt.icttht antim 1 /4,)•err

arratat TITS1a Pai ZN arrr-aA fciNviey_r gNf ftzrr wrirw, f'fr# fdTm 61.)• TR flu-4 tkcopi tf arr S ar-IRTR fazsDvicyrzr povvr cm4sigl t Trwth I

57a c3 1-1.1 cre1 fit-AT 37-4-4.T 3TVY9 lciR1ciiei4

T4ET-C9'S -Rea i Rcrf4riev-r S atIv timr cwir, T-errzfr f4f4, \914i1-0 1=4RI zrr 3TRT fAtr UvIT

*114-Acft 3II41vict) Itiitatrd q-04

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image23.tif

3.34:5553 52,: 5:555 a sunxzmx‘E EEEEEEEEEE Efimggwfififlflgfiafigg Eggggfigflafigfig figrfiwfiggggwgum I . iEEEE Efigflgfigfiggg «fig E_EEEEEEE§EBE£_EE mewfiwEwEEfirEgFmfimEmwfifiga Eggfifigfiflwfigglgggé _EEEE$E EwEEE.§sE%¢N@E§Ee Efibfiwflfiwgflfififififi EEEBEEEfiEflvfiEE Eminewwfiegwfirflfifibgmflgfigfiwg .EEEEEwEfiEEEflsmEE EE:£E%E%W:SEFE . Eégfigfifi EEEEEfiEEEEEBE _E.Eg5wfigwflafifi5m~§g§§ EEE¥EEE_§E§§Ew§E wEfiEfiEEEwfiggEEs . _EE& ufigfigfigfimfiwflggfififiwfiffim EEEEWwEEEEmEEEgEE gaggfiafigfififififihygg, .Efigfirfigfigrgafimfimgmgéfi Egggfisggéfigfifiwflwfiwfifis éfiAmVEEEEmEEEEEEE fiEEEEEEEEfiEEEE «Egfiafifiémwfizfiggmfiggfifi €9g9£m§sgeswfifima§s§a§© MENE ”EEEEE.§WEEWE€EE®E .Efiafifigfifieggflpfimggwgg Egfigwgwflggfigfiflffifigfi Efigéggfiggfifigfigflgfi Efigwflfiflégfméfifigé BEEMMEEEEEmEfingEE @EfifiEEEEEEE—Efifiwfiflwfi meow .E w .mva E St VFIVW

sicc(ttI3fl-TRUf1Iu1c, 63P137, 2019 25

f- 4914c4T 61-114 we'er

5841) Tff arfeggff wctiet&t qnqfkcr q4k •flov-1 'MC # 3rlTh419-r W<I I Hick1l l9T Tr-t-th ti

(2) T4Trt41 -0(-04I A ancoor. VM4 iaI1irtkft P41414 f*--iWZgcr 711 t tichtif *yet W15t g

tTNT 4 met 311ETRT (1) I tWilrEgT cfN4

Mg *lag i5T c-i?rr4 ciiT A tit ;

tIRT 4tt 37-TRT (2) t 311n tiReilvtir ftql8 ar---egiz

arR:r ftWt11.;

(Tr) arRi 1-11 4-1a, Tfr 3Tf1ftzT4 arerff Piwwioftgm WO 14)=4 umi zrr tr 31-mt ti

59-(1) '11\34 *NOV( -@11 ffi51t Thlt-gid . -RPitccf: 1-f4vr timer arf~ wr-4- 11 ik 3arrizi4 -uurnff ufa- tmnpir

3T4ET k 7 (r)t4 sgh-A-9-Ik4 zr6- Ithi tizr*Tft aTRrizrrr 31-rtzr TIM 1**4td arqtr gio-r ar@W:a NEZFEltff -011

TrRw Trftat zrr eilLr vcr er arruzrT zrr ip4)-414 wilt ;Kra

i-Nntzru ft Ti:r aTftikzwr arrRzT 4* f4-9-ET 3:1M qizt Trarff \I-If 0 .arr-a-ta -R)Lir jiiZIiiit

(2) WIWI- (1) Mit9 R4I TRH lick) 31thT, ftg ttlIcf 71247471-474 tf1;1 -1 %TM 4iu5ef •414.1I TITIET .tY.af -Wg7TT I.

60-31W4gm f4g4 31:146t gi3111111 tcm1-1 ‘301-1 'tk 0c4 wild tat451 q4eN1 ‘it-cH cravf gkr4 ItRit gpa q-R)Trr

61-T NtegiFf 3113. ff-4119. c&T Wg iiFIwit 31T-41.4711 3t17

fP0441t zwa-,ET qzcifhilevilt irreau arvviir Wm.gkrei %TR gl•< 41141 lit ?St 3.TR4 qRr ar-- F4- wr-d grom:a, 61k- gz1

lit spirit 6)

62-(1) "R:f aarfgarf argit 1 21. -ItitY4i147c1 Meggrf crr-4# 614 rR i*Oci ii4is4 WO" I

3TIE1RI (1) \fc'-eiracr Suitt 1 # TV1'&44d Meg-gift

Thai 614 er 1ft facr aarniPt wiferff quIdtlieril 114 Trzi wrtcr faftrzr ThanRcr arRe4zrk3frAu uur t1416(14zU 3i1iwr7

uP_TT writm TIT Strr 3Ttirff t14-14 v1144) I

.0:1 Arfkg11 ThAlfki Rv)- Mt IThriI4!e14 3P14 iiT614-Ta IvSäci alkat Ntir9 aTcr4 trfflkalti, Narre-st at17 cisPfccr

34-1--t-cr coli3/4 utiik gq

afepTri critiT \r- Ther 3rer ‘igircH ctN I

63-TH 311eggli 3ra gffl ed-e t4tsccN

;r4Tr .<1,r4 IT 9EI4) 34v4'a'slt gm wad- fdalhievr, ITRff451

Tifdtum rjuih 30 gl.(1 ZIKT 1)xlt4Act)K SWF (Ma .41

VI 7 0t.? mar wrWr

f44T-4.1 Th-T 4 I srbr 14Kil -taileto Itzu

ate4trii 51 anrrilet srffra

f4-i-frq a& wig (wit

Mc41t1 fasaltarga

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image24.tif

E flag mm €8§§5€$ 523. 5:55 « man—£5.42 EWVEEREEEEEWEMOMEWE. EE.ERQE§EEEEEWEE ngmfimfifififigwmgufiagfié _%EE§%E%EB@E§%E%§ E‘EEEEKEfiEQEfi «E Eggggmflgrgwma u _%Egawfisfirwgsfikfl5g EEEEW.E%EEEE?E EEEéwgggmg EE figfigerEmSES _%EE&E%E%§ Eggéwvgfigficle a .fimfigg «mwfiEEExEWEEWEEEEEE EEEEEEwEfiE fig .%E_§?Ewfivmvfi§fils , SE EEEEfiEEEEEE E Eggggfigfigrgio ..EEE%EE®EEE%E§§EA wEEfim‘EEEEwfiEwEEE .Egfirgfifig Efigfiwfirflfiwfigfirfiflafiémfig Efipfiéggfiauwwufifig.§ «Egfigfimfififigsggg wEfifi&E«EEEwvaEw Egfigfigfiflsfiwgfiggfiflwfi EEHEEE;€EEEEEQY% , . ._mEfisEE EEEwfimfigEEwggE . MEEEEE Erggwfizwggfivgfivk V mgfiEEEfimEEfivfi Egfigfiefiflrfiswséfivgfiv Inm.Efi\mfiwfiEwfiEEEflfiar EEEEEE.E§EES .EEEMEEmEmvflarE .EEEEEEfiEWEEEPmeYfi ESAEmMEEEEH/Em

26

'iccfl Trat4T 31-4TIVRT +RAC, 6 3PW1, 2019

(Elm 8 t€1)

wo 24 talclIT WI. 79 144 wr Wang jcflus Atar0711-4TT 1418, 2004. (inn TraTT di 111501 9 19 * Je( ftrearFa, m I

21304). dA11,1111 Rile 27_02_2004

;40-el *Saar d W. anti Ve`ST fiTli, 2005. (ictlt T*4 81FtkITTI RPra Th4flEJld4. I dlitei , icit 11-4211 tItell 11 '92005). eRifT,11-41 ftifw 24.3.2005

71 4 RT-41.40-40 . eel( utiT di Reli. 2008. (ielt nu dlIi1q 11.1011.144 14 Ellet 31 1 ., itit 1112T1 TIT 32'9 2006) dIR*),011. Rife 30.10.2006

1R114 4111.-4 irriall tin, Th4I€JIcl1I. th‘pt wan 1

9741 Ininft fdreauran . ear( wan oi IN. nu

(aCO( Trau 3114141111 *SIT 29 19 2008). 3TRIV-TI Rum 05.9.2008

42N5 118ic111 Thraf'auran . aff2 wan ,MR4flqq. no& Wu wan 42Inz nbl4l1 Th 'i1awei.

IblAgis tits4T 30 19 2008), daltillT R-lie 05.9.2008 TrII4141 . yawl

21797 RlcIf1I14. 4z-i RT9-47 eel( wan 1

21 fannarnn. ,ialt 0-421 dlRIIktIlt 2009. (iccrt nu 41IIIiHiii9I1T 14 19 2009), daitki-1T Rife 24.3.2009

110R10'0 P41-410711-411. izieli 1742T 4 4i, 2009, ('ant SI*2T dI1?1f1q 4ov11aeo faranran. min. Ithi 1 1i1381 21 '92010). datitliT Rile 01.9.2010

nett' farearan in wan di tilt 2009. (4cTit Sib! di IT ref 192-4R/TT-40, nef. 'actil Iran 1

fraragran, qlRiqu.I.L 1-T5TI1 22 19 2010), 3TR1-tr1T R-110 01.9.2010

'11ii4. R.7l1€Jlv1ZI. atnt maw ea 1).K no, (tint( man di 4 -4-424 ictl Tre2T 1 1i1g8T 23 /9 2010), AIRIV-T1 Th-lie 12.10.2010

41/4*-4 $-c/ nier x14affitt, 47 *-CeltileT ant& V99 ithr ..,, 4q. 2010. ('act Tau Ril'Aiinntnn 27 19 2010), difAntlif Riie 12.10.2010 I itt.gi i , Taut

ii- arrlonoaoRno f'dxidninn. 11110•1 wan arid IN. 2010. ('ann ran anloeno4o[nio faraltaran.

1J04 911911 24 19 2010). dAtte-IT R-94/ 12.10.2010 -n 34thnffr 4413-( 1 , An, ligmiiic 1

4 km-ann fdrarcargn. 9U1aV1r Anto nrn I

-ti faraaran,

4 4022,2a frralWarnit, nm‘ van .sifP N. ado. ('attic Trau

dII PI1IB 3433111 26 19 2010). diMirlif R-114/ 12.10.2010

.wrq, 4 ATTT faelnele10. a99 wan 4IIbf.1q. nu), ('ante Iran nix tttefl r

'aiRiPiiq itnn 25 wr‘ 2014, dif4121-11 Rile 12_10.2010 deal* I

4faith4 f4xede1le14, daft rain at qq. nu. (oct11 Iran aiRflqq Io1i1Iqu'.rfanfaufgq,

/OA1 14 19 2011). 41910-17 Rii4/ 07.4.2011 I T1914 1

15- t 1.424Th lea. tailt irtsr di cm, 2011, (dal( 0-411 dlRlPj.lq 11-110t el €114 . 414 ,

10911 12 19 2011) datt:4-17 Rile 21.6.2011 I 49141 i I

is- oft Item*,i 4'iIkqvq RMautot'& 41 ,(Illana 114Rqut faraway, um‘ war di /N. 2011 (4c4t Mtn diRATPT Itt9TT 1 19 2012), diRtvilT Rile 04.7.2012 11

12- 18,414 ar4 n 5 fanftaran, -4-TI 116J94. 3141 nta Attila 1447 Vfft 0di 49. 2005 (unit wan nf0fAlor nnw 19'9 zoos). qAttypff Rule 19.6.2006 1191 1

of (1)cf Ti, 4 , 374t di Ii . 9. •qater allfit . nwz 1242T 41 11$1. 2011 (sitet Itu 0141;98 ittRIT 2 IR 2012). eRitt.141 05.7.2012 t15111% 1

win farearran, nw-f nu di 441, 2013 WIT fanitaraz. wrntg I (two nu oladt;871- U9981 1 19 2014). di Is •ff Rut 10.01.2014

911f7fd faraman. am' wan arliteavq. 2011. (oct11 van oiMI.tq*ma luRid faraltaran 44n,

3 19 2012). tattalif ft-ii. 05.07.2012 *MI 1, I

Q41 fardtam8. UM itil dIEPnIq. 2014. (0crlt 9-4W .jihtiRiq.i Uliu 8 Q41 ThqIaioiq. dit Uffi Irani '9 2014). dalto-17 f8-17* 04.3_2014

4Kno faraaran. flin 61414. fibq MIMIC az wan n qq. 2015 4o[nio xo rang, Ilya bt I .

(aMq 0-4W 31R1fta1ll W(3/if 719 2015). dlIbtLePfl f4-41* 24.6.2015 Si I

n- antoartokmotto 74 U100. itur UM rim ailbPlqq. 2016 aricantoRquao faraway, Oa. MI Tau I (aw wan adbfganr nun 32192016). attnir fanin 03.10.2016

442 tcl 1071 718.9 Riff UM IMF di LPL 2016 tau Pazattaran. 4z‘ i ‘ .

('anti 9-4/1alltegazI 1t8211 2419 2016). 41fRIVI-R fkurt 16.9.2016 1 09161 I

utat ock a1-1ef ThqThuua. VM litif arlithan 2016 ital 8 CI ail . TIM I (eclat nu arfite4:4 au 28 WI 2016) aiRito-11 ref. 16.9.2016

iiuki0 ThqThuiouq. UM, 7171 UM 17411 do WI. 2016 - tit% n Enci . STK 7n9T1

(aff: nu amizan num 20 WI 2016). aitZ)tri-ff ftgre 16.9_2016 Are fanfinran w€24-* nfff nu aft1141171, 2010 (3M lift 741191:408 1191 tillalt91ot8, WEIWW, MI AN I

472871 27 89 2016), 0R141,0-11 Eta 18.9.2016

191_RPH_Dala 4 Vidhaika Folder (Adhioiyam_2019)

image25.tif

WWWW,6W, 2019 «11110—1 (511111 a 721?) '— afifimmfia‘m WWW 2004, (05.1055015102111QO 2004)31h'1fi1=nfiwz1.022004 ZMWHWWW 2005,(am97‘2131% 11121111 1112005) afiifimfiwm 24.12005 WW, mfiuififiufi. 2009 Wfiuaflfifivm mammogmmmmmos WWW WW.WI WWW. 131111131111. mm” minim WWmmmoa),mifimfimas9moa 6— WW, mmm 2009,5101me 141112009), WWngooe 7~ 0110031000 Mam, Wfiflafifiu‘m 2009. (ERR aim 31W 11150121912010). WWOLMON 0— WWWEEIW. 2009. (emu—"331m 11811221112010), WW0191010 9— fire {020mm,mfiua1fifi1m 2010, (Bavuéumfifilm 11190231112010) Whammjozmo 10— WWWVEW, 2010. (afifivfil 4A mfimmfififiam.wmqhfiumzuna FWWW (ammmfiuwmzefizwa).m1fimfiwffios9zona W, #13. W11?!“ 5— fiafimfiwfim.mvfirm.moa,fimwfil Mmmhfifiam. w,muéwu 311131 WW. Em, Jam-1972111 0110931000 W. 112:0, am 1172!“ mm. fifih. am 1112211 Wm. WW3. lama?!“ WWI—13512115131, sz‘lmmw), WWuJo-mo 1110111251711, 9101111911 11— méowoé‘mnm W. W 11—531mm. 2010. (BER fin eroWoaotwo fififiafivm 313mm! m 21 111 2010),:11fir1fim m 12.102010 film an W W. W 11:. 1131211111 mififlfifim.mfiumfifiim 2010,(afir19§¥1 Wuhanmmw). Whammwmw mifimmfilfimnfilfi (31—111 11%?! mam-1 11w 1 111 2014). War R1131 10.01.2014 WW. m“ 31W. 2011, (am WWW 3 in 2012). 31mm W 05.01.2012 «MW, mfiafifi‘n‘m 2014. (amfiafihmma 11—1 2014) 01mm: Rm 0432014 W. WW 93551515001015 finfifimhfifi'fimmfinififim 2010 (Gawain “Mam—ham. Withsmzo10).mfi=1mu102mo m1 mwflmmm 2011 (9611mm WWW. man 14 W 2011), «101521 was 01.4.2011 WWI 'W.Wufirqfihm.zo11,(amvfiarf§fim WW,W. 111911 1211:12011)afinfi=11fi=11‘621.0.zo11 WWI ahmm—fififiam.mumum 2011 slim—mu? hfififim, (ammamfiwww‘m1 1112012),a1fimfifi1'7604j.2012 1R1???“ www.m—fium.ms Wmfifivfififiam (ammafimmmmmlafimm 19.6.2006 my“ afiWWufiEfihfl,mn EWW,WW WWWWZWZMZ),WW 05.7.2012 m1 “Mia-1mm. 201:1 mhwfifima’n.mgn (amfiuafifimmnfim1s).afiwfifiwmnzo1e (ammafimnmrmzms). afimfimaizmzms Mam-0| 316W. WWW, 201s -' “#0911060 mm ha -« 5mm mmmm:.mm1s).mmm 19.92010 WWWW,E10 (ammmmzsfime)afimfim1s9ms 9101mm T’wzm » (amuéuahfiwmzofizo1s)afimm1s92ms mnfim10)afifiimfim 1992010 l9l_RPH_DaIa 4 Vidhanm Foldet (Adlliniyam_2019)

‘,Icck Trat4T.31R0V1R7 lut , 6 arTiTT, 2019

rat-2

(4137 7 ts1)

wo fdscif4cueia wr km m-r Awl'

4, -1M I

Oiler 100 eilei4 81?4ffi101, 2004, gen 44 Von 9 179 * MN

2004), 4A1,1111 R-1(4) 27.02.2004

\ a • 94-111e,

Ord./ ReXT I V lINA feredRITH9, qa“ Wen 311i2119421. 2005. ( ukur 4IRIPI.lq

iienT 11 1I9 2005), datEreff Rik/ 24.3.2005

)1ldIJ4cM Arderardu. 31 1id, Ocrie ;in I

1111c41/444 Xri WW1 , sicti wtr 31R1f429, 2006, ( tie Re!! ,MRIPiII 'T ti(en 32 19 2006) 4Atkelir Rule 30.10.2006

inn An-et forofearva. 9741 Cdaell-4 Triredl ThlqRcJielq , Ord wen 311n1949 2008

49, Out/ miw I ('init Ilan 4A1)1111 VVIII 29 29 2008), aikellf Rif co 05.9.2008

Mn b I el q.

af7I9 Tra412 fdTeniwi , 4ccie '2 air 3161 q , 2008 ( We utur 3111PI1B t1(5111 30 29 2008), 4•1ttel4T Rife 05.9.2008 9(141414, Orcie 174n I

i,ic,ir faraarKii. 1IZ1 trdi, %tall

wen! 111(41 RXri1delle14. Out/ yen 'IIRIPflIH. 2009, lita 31Qill4119 nun 14 T9 2009), atkelli f'd-914) 24.3.2009

Ank1 F020 fiqlulvi4, 117121, Occie

11221 I 11:12-9020 ferednivv, Ocrle Wen 3112.11"429, 2009, Ten

oi1Piiii iteRIT 21 19 2010), silb9,e111 Rile 01.9.2010

eqftei RviIui0iq. a •scrit lien!

*flat! fornteriv4 Ocrle inst di q . 2009, Sten 311412.494 1n5111 22 219 2010). 3TItifFqi Rue 01.9.2010

A Aqu Tail . Arawau. ultuc, <tan

veXT I Hine foraviv4. vIcrie IfeST 311nt499, 2010. utur

'(s41 23 19 2010), daltellf Alirl) 12.10.2010

flu. i \ q. * wq-a- tPiqfllcft. 9112-41 *-Ce•IXI-Ice 104 . tirele raw ait1i.pi. 2010. ('nil diArAtIg 2423111 2719 2010), RIntkeill felirn 12.10.2010 li 049.04 ie. elcde IteXT I

11-' arr4outuotTourfo Autkurda. oast/

f4erft 4g, 39402160inV90 Thiqkweit ticcie Ian di q . 2010. ( We wan altreduu itgur 24 29 2010), 4A9,)(1-17 Rik) 12.10.2010 MR WIT( •quiciti,

isaqiql< I

4 t fdrecarKii, +NAO.

4o4to kin I Al km-ture faZO 131(44. eIrrie veil 31R1XIN, 2010. e wen

,dIPIil #50T 26 29 2010 diAvi-Ir Rule 12.10.2010

art 49134 u-e fdgaid Reek ell nen) 9TTI feravall, Ott wen RlPi11IL 2010. (tele wen

3111119471 20341 25 29 2010). 31149,1•11- R-11.5 12.10.2010 tenth I

faraard-a. lei lh4

11e111124141 MVO eitc14, Ocrle raw di . 11 , 2011, ( tell rat 421 212RIT 14 29 2011), 4A11,o4T Ruts 07.4.2011 11 01194-1 lel

In truarduran. 14.11.

00:1116e faetrarreit, elcrie wen JIRIPiPI. 2011, crie wen 3Fite444 Tinn 12 29 2011) •SAVI-11 Rik) 21.6.2011 11 0.141 VII

41 •(19 9 Arama. an 119trien4 11 rice fdraviv-4. O wen fA4111, 2011 neirirtn I .

(Ocyle wen 411"a)421 Vent 1 29 2012), atellf R114) 04.7.2012

'S 6"1C i Aueturdt

991-11< 31-41 41 9i Ardftardu. •Scri Wen d&JPIIPL 2005 eine I

('iccit i;rtur ..eaAtid nv111 19 219 2006), toir A-110 19.6.2006

18— V 9, tt. ea4 cnerw.

q icasof 704 , qccir lien iIWIPIPI. 2011 11912-19e I

(Ocrle ;WI 411W)411 inRIT 2'9 2012). tiiiiqi R-110, 05.7.2012

FRIT faredurdu, euuI WTI ilvard le14. Orrle Men 41 11 , 2013 •

(ttcrie Wen siMAiik ituur I kru 2014). toir Alia, 10.01.2014

Uklu. 1

.2211im faXeirdelim4. Onle wen di il , 2011, e wkir N14411 si *I x-it(

Itairdwgzi. 44 all. lel 'nit TetRIT 3 29 2012), atkei-IT Ruts 05.07.2012

441 feted-awl. Ocrie wen 41 WI, 2014, ( SWF aIRAqii utur I *nil 8'9 2014). 41Ritkeln R-Ii0 04.3.2014

tree 11, firsturart. 14/11)41414 I

4Krao faxgracutia, fOrsterarq, Thrc uiiiiC 'int'l ukur Att 2015 (.scur irtsr diAAmt 4734T 7 29 2015). 41 924-11 RIIM 24.6.2015

aw4o3Triorrotto Arditarek km, autoarrioenotto AvaR le14, tiv VW Tien if. 2016 12111( fill uta 4AAmi utgur 3219 2016), ratkellf Quirt. 03.10.2016

tke fkratuat ileu utrm, Ike Araurdu. Uri i mdr u--au ran di q . 2016 11 01190-111e

w-avr 441-Anw Trfizif 24 39 2016), iiRi*tuur Rue 16.9.2016

WMI 9oc,c.hiuoicarawat wi-al 1

4int 4 x4Xinte AredEu-du. a-mu sitin q. 2016 (sca( Ten 41109114 205117 26 29 2016) dSltjur Rule 16.9.2016

2rtikfa ftretarat srm. =nun Tinhga RiqRclI&L WRIT, MTV VW ithr a4 . 2016

t 114V1 diNAuu IttnT 20 29 2016). 31149,1141. fell. 16.9.2016

'nu re tkvamwa. an. zr—i 1 2T1 RtqIZuici4. Wffn VW rail di q . mut at( wain

41Tflqq ite17 27 29 2016), 31R1t041 Rile 16.9.2016

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image26.tif

WWWW,6W,201Q 27 11331 2110101111 Wall 20 E 2010). W 12:11:: 10.9.2010 mifi—z (firm 7 3!?) am 31W an fimvr Wm an an 1— mafia—01110011019100.2004, Wuwmfiuwfiwgm www.m1 J 2004), Wm fi—vn‘w 27.02.2004 ‘ 2— Eqfiflfifififlm,mfiuafifim1zuos1wfimafim MW,W§§W 1119111 11 W1 2005), W W 24.32005 W 113311 __I :— WW‘WWW,ZOOS,(WV3H WW,W,W 3101mm Wm 32 W1 2000) W 12110 30.10.2000 973!” 4— WWEWW,WWW,2003 WWWWJ (W W M 112501 20 W1 2009), 91W Ffififi 05.92000 W. W “73‘“ 5— NWWWW,WWW,2009WW Wmmfifififlm. W m :10 W1 2000), W W 05.9.2000 , ERR 1173211 0* WW,WWW.ZOOS.WWW WW,fia=fiqa-1,m Wen 14 W1 2009). («film W 24.3.2009 973311 1— 11110031000 mm, W 0331 01W, 2009, (afirx' W231 momma Wham, 112m am 311211211111 man 21 W1 2010), W?! W 01.9.2010 Jim 0— WWWWW.2009,WE€HW WWI-111122110011 Wan 22 W1 2010), 311211131711 W 01.9.2010 a?!“ 9— mw,wuéwafifiuwzmo,(afifimm Tmmm,mmm Wan 23 W1 2010), W F5116 12.10.2010 T8311 10— WW1W,WWW, 20101970191231, 010313???me 31W 111911 21 W1 2010), W W 12.10.2010 4 mm. W 11??!“ __| 11—' 31110016030090 W, W r331 31W, 2010, (am 01221 “009506100210 Wm, 3117517 01121101111 m 24 vi 2010), 3110113121 1231'? 12.10.2010 61W 311111133 was, m 213, ml 12— an tin—em Wm, W 92:1 W, 2010, (ac—<11 m 11'! am ham, 091112-11 mm man 20 W1 2010). 3110113121 W 12.10.2010 @0010 WI 13— «Mammalwfimaflhfitmzomfimm :11me W m 25 W1 2010), 01121331711 W 12.10.2010 61191371 14— www.mmmJouWfim WWW mam “Wan 14 W1 2011), 3113113?" 0:05 01.4.2011 Wm 15— Wham,wmmm,zo11,(amma®fim WW.mfi 11w 12 W1 2011) W W 21.0.2011 WWI 10— mmflfiflmfififimfl.mfium,zm1 mmfimhfifimfiw (3W W W Wan 1 W1 2012), W11 Rm? 04.1.2012 WI - 17— Wmfiafimfl.mufiumfiuwzms Twifififififlfififififlm (am 9?“ mm“ "Wan 19 W1 2000), W W 19.6.2000 WI 10— afifimfiafiffl.wfiwafifiufi.znn amma,mm, («RR 9%?! mm m 2 W1 2012), W R711? 05.1.2012 WI 19. [WW.WWW,ZO13 - www.mgvl (BER m 3101101111 WW 1 W1_2014), W am 10.01.2014 20— WW.WWW, 2011, WWW :l www.m1 man 3 W1 2012), W Rm? 05.01.2012 21— rafifimfimm.mfiwmfiw,zou,(ammafifiw WWW,WW Wan 9 WI; 2014), 9111113?! WE 04.3.2014 ml 22— 6100-00 mm, W, MW W res! aflhfim 2015 01012110 Emmi-m, madam, 1 Mean rear mm Wen 1 W 2015), «figs—~11 Feats 24.0.2015 W1 23— “Woman Wm, #73 W 11311 01min, 2010 ,eméoméowfio Wham. 111a, (am fin mm m 32 W1 2010), W31 W 03.10.2010 W 1173!” ' 24—Tfizfiwfiam,dammmafizfi1mzms www.1aarm . (am flu m We" 24 W1_2010), 911033711 P0111: 10.9.2010 Jmm 25— fiiflsvafimafiufium,mmmfin,m10 WWW,MI (am 1172!! 111010011 11190 20 $5 2010) am" W 10.9.2010 f' I" Wm,m,mmmmfim.zme mm.m.m1 19]_RPH_DuIa 4 Vidllaika Folder (Adhiniyum720l9) 20— (am 21— whafium,mamw€uafifim. 2010, (01mm 31mm Watt 21 W1 2010). W W 109.2010 100 mm, m, Wham

28 ‘3c;t1 ra-71. 31- l1tTRT qvid, 6 3PTRTI, 2019

w-c—a-vg atti- cmui

f14-4- 06 9b-701, 2008 M 3Thit9 iii4c1ct, Ricwcif *3-TTIN itfr19"

gkl •t1crn4ti f411 'NY41411(-14 .P.ITferff k InPct -14)?.1 Tit 1 tit

vo sum . *ftRr9 aftatri fer tat -4 1'4* faxcatheiiI* augaur : ' -

CO ‘9411 37-4-4.T 1651 t I 3M.: 31-49T Tur afftrr 34-TA-grd <N4 30 \ivel 9-1411# luicivetr

Trr-44- Mv4iPticr <re4 mytf sttcbr( Th°1 nriim agiAcrcflllum wq-- <frog.

mitfftrirtrrti

ardkr4 fst cr- 1 fa 31119. witti o e

31itaT aitrfttriT emief ‘3114 m -W)Tizr fstrr Trar 1

acltir( \icc-PZ Maxi' ffilf Rzeiravieuf it-)zfT, 2019 7:itt1fferd. fbir wild( t I

aTrur

o glur tiNcri

No. 1451(2)/XX IX-V-1-19-1(Ka)11-19 Dated Lucknow, August 6,2019

IN pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is

pleased to order the publication of the following English translation of the Uttar Pradesh Niji

Vishwavidyalaya Adhiniyam, 2019 (Uttar Pradesh Adhiniyam Sankhya 12 of 2019) as passed by the Uttar

Pradesh Legislature and assented to by the Governor on August 5, 2019. The Uchcha Shiksha Anubhag-1

is administratively concerned with the said Adhiniyam.

THE UTTAR PFtADESH PRIVATE UNIVERSITIES ACT, 2019

(U.P. Act no. 12 of 2019)

[As passed by the Uttar Pradesh Legislature]

AN

ACT

Short title, exten and commencement

to provide for establishment of new Private Universities and incorporation of

existing Private Universities in the State of Uttar Pradesh under this Act for imparting higher education and to regulate their functions and for matters connected therewith or

incidental thereto.

Jr Is HEREBY enacted in the Seventieth Year of the Republic of India as

follows: -

. 1. (1) This Act may be called the Uttar Pradesh Private Universities Act, 2019.

It shall extend to whole of the State of Uttar Pradesh.

It shall come into force on such date as the State Government may, by

notification in the Gazette, appoint.

19I_RPH_Data 4 Vidhaika Foldv Adhiniyam_2019)

image27.tif

BEN 9&5 WWW Jae, 6 31‘ W, 2019 WWW ' Wfiaimoswnfr zoosnmmmfimfififimr Wmmfinfifimfimfiflmfinqfifivfinfifinfifirifiififiwr ammeammeemmemwmmmemmgg afiéwmafi§a¢wmaflfiammafirfifimfi§mfinn Wafifimfiwflfimwafififirfirefifimfiamwfimm- mfins‘rw‘é’r wwwamamwmmawmmg mmmmmmmwer mefinfifimfiwfimaoigfiwfiammer 611311 it, no dro Rig-II, age Hfirar No. 1451(2)/l.XXIX-V-l—l9-I(Ka)l 1-19 Dated Lucknow, August 6, 2019 IN pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is- ‘ pleased to order the publication of the following English translation of the Uttar Pradesh Niji Vishwavidyalaya Adhiniyam, 2019 (Uttar Pradesh Adhiniyam Sankhya 12 of 2019) as passed by the Uttar Pradesh Legislature and assented to by the Governor on August 5, 2019. The Uchcha Shiksha Anubhag-I is administratively concerned with the said Adhiniyam. ' THE UTTAR PRADESH PRIVATE UNIVERSITIES ACT, 2019 (UP Act no. 12 of2019) [As passed by the Uttar Pradesh Legislature] . AN ACT 1 V to provide for establishment of new Private Universities and incorporation of ~ existing Private Universities in the State of Uttar Pradesh under this Act for imparting higher education and to regulate their functions and for matters connected therewith or incidental thereto. IT IS HEREBY enacted in the Seventieth Year of the Republic of India as follows: - Shgn title, extent ‘ .- 1. (1) This Act may be called the Uttar Pradesh Private Universities Act, 2019. an commencement (2) It shall extend to'whole of the State of Uttar Pradesh. , (3) It shall come into force on such date as the State Government may, by notification in the Gazette, appoint. 19I_RPH_Data 4 Vidhaika Folder \dhiniyam_2019)

\Jcek 14 xf 3TRITUNuT 4 iv1d, 6 31-711T1 2019 29

2. In this Act, unless the context otherwise requires,- Definitions

"Academic Council" means the Academic Council of the University;

"AICTE" means All India Council for Technical Education established

under section 3 of the all India Council for Technical Education

Act, 1987;

"Board" means the Board of Faculties, Board of Studies and the

Planning Board, or any other Board of the University;

"CSIR" means the Council of Scientific and Industrial Research, New

Delhi, a funding agency of Central Government;

"Department" means a Department of Studies and includes a Centre of

Studies and Research;

(1) "Director" means the Head of an "Institute", "Centre" or "School", or the

person appointed for the purpose to act as such in his absence;

"DST" means the Department of Science and Technology of the Central

Government;

"Employee" shall include teaching and non teaching staff of the

University;

"Executive Council" means the Executive Council of the University;

"Faculty" means a Faculty of the University;

"Governing Body " means a• committee constituted by the sponsoring

body;

(I) "Hostel" means "Scholars/Students" Hostel of the University;

"ICAR" means the Indian Council of Agricultural Research;

"Institute/School" means an Institute or School established by the

University in accordance with this Act and the Statutes;

"MCI" means Medical Council of India constituted under the Medical

Council Act, 1956;

"Minority Private University" means a Private University established by

a religious or linguistic minority of the State of Uttar Pradesh;

"NAAC",means the National Assessment and Accreditation Council;

"NCC" means National Cadet Corps;

"NCTE" means the National Council for Teacher Education under the

National Council for Teacher Education Act, 1993;

"NSS" means National Service Scheme;

"PCT" means Pharmacy Council of India constituted under section 4 of

the Pharmacy Act, 1948;

"Chancellor or President", "Pro-Chancellor or Vice-President", "Vice-

Chancellor" and "Pro-Vice-Chancellor" means respectively the

"Chancellor" or "President", the "Pro-Chancellor or Vice-President" the

"Vice-Chancellor" the "Pro-Vice-Chancellor" of the University;

"Prescribed" means prescribed by Statutes;

"Records and Publications" means the Records and Publications of the

University;

191 RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

image28.tif

Wmmwmmm, 2019 29 - 2. In this Act, unless the context otherwise requires,- Definitions (a) “Academic Council" means the Academic Council of the University; (b) “AICTE” means All India Council for Technical Education established . under section 3 of the all India Council for Technical Education. Act, 1987; (c) “Board” means the Board of Faculties, Board of Studies and the Flaming Board, or any other Board of the University; ‘(d) “CSIR” means the Council of Scientific and Industrial Research, New Delhi, a funding agency'of Central Government; (e) “Department” means a Department of Studies and includes a Centre of Studies and Research; ' ' (1) “Director” means the Head of an “Institute”, "Centre" or "School", or the .- 'person appointed for the purpose to act as such in his absence; (g) “DST” means the Department of Science and Technology of the Central Government; ' (h) “Employee” shall include teaching and non teaching staff of the University; (i) “Executive Council” means the Executive Council of the University; 0) “Faculty” means a Faculty of the University; (k) ”Goveming Body " means a committee constituted by the sponsoring body; (I) “Hostel” means "Scholars/Students" Hostel of the University; (m) “ICAR” means the Indian Council of Agricultural Research; (n) “Institute/School" means an Institute or School established by the University in accordance with this Act and the Statutes; (o) “MCI” means Medical Council of India constituted under the Medical ' Council Act, 1956; ‘ (p) "Minority Private University" means a Private University established by a religious or linguistic minority of the State of Uttar Pradesh; ' (q) » “NAAC”‘means the National Assessment and Accreditation Council; (r) “NCC” means National Cadet Corps; (s) “NCTE” means the National Council for Teacher Education under the ‘ ‘ National Council for Teacher Education Act, 1993; (t) “NSS” means National Service scheme; (u) “PCT" means Pharmacy Council of India constituted under section 4 of the Pharmacy Act, 1948; (v) “Chancellor or President", “Pro-Chancellor or Vice-President”, “Vice- ' Chancellor” and “Pro—Vice-Chancellor” means respectively the ~ “Chancellor” or “President”, the “Pro~Chancellor or Vice-President” the “Vice-Chancellor” the “Pro-Vice—Chancellof’ of the University; (w) “Prescribed” means prescribed by Statutes; (x) “Records and Publications” means the Records and Publications of the University; l9I_RPHVData 4 Vidhaika Folder (Adhiniyaln_2019)

30 kiCth SlY1 31W11%117u1 qui( 6 31-Ter, 2019

"Regulatory Body" means the statutory bodies established by the Central Government from time to time such as University Grants Commission and includes the All India Council for Technical Education, the Bar Council of India, the Distance Education Council, the Dental Council of India, the Indian Nursing Council, the Medical Council of India, the National Council for Teacher Education, Central Council for Indian Medicine, the Pharmacy Council of India; "Schedule" means schedule appended to this Act;

(aa) "Sponsoring body" in relation to a University established under this Act means :—

a Society registered under the Societies Registration Act, 1860 (Act no. 21 of 1860);

any public trust registered under the Indian Trusts Act, 1882 (Act no. 2 of 1882);

Conditions for the establishment of the University

or (iii) a company registered under the Companies Act, 2013 (Act no. 8

of 2013); (ab) "Statutes", "Ordinances" and "Regulations" means respectively, the

Statutes, the Ordinances and the Regulations of the University for the time being in force;

(ac) "Student" means a student enrolled with the University; (ad) "Teacher of the University" means Professors, Associate Professors,

Assistant Professors, and such other persons as may be appointed for imparting education instructions, or conducting research in the University and are designated as Teachers by the Ordinances;

(ae) "Treasurer", "Registrar", "Finance Officer, "Controller of Examinations", "Librarian" or, "Proctor" means respectively the Treasurer, the Registrar, the Finance Officer, the Controller of Examinations, the Librarian or the Proctor of the University;

(at) "UGC" means University Grants Commission established under section 4 of the University Grant Commission Act, 1956;

(ag) "University" means a Private University established or incorporated under this Act.

3. The sponsoring body shall, for the purposes of establishing the University under this Act, fulfill the following conditions, namely:-

create a Permanent Endowment fund with minimum of Rs. 05 (five) crore; duly possess contiguous land of minimum twenty acres in urban areas or fifty acres in rural areas earmarked for the University:

Provided that, the sponsoring body shall not sell, transfer or lease out such land or any part thereof and also shall not use it for any purpose other than the purposes mentioned in this Act for the functioning of the University:

Provided further that such land shall not be mortgaged to any person other than a bank or financial institution established under any law for the time being in force for any purpose other than availing loan for establishing the University;

91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image29.tif

W WW Tl'fi'c', 6 W, 2019 (y) "Regulatory Body" means the statutory bodies established by the Central Government from time to time such as University Grants Commission and includes the All India Council for Technical Education, the Bar Council of India, the Distance Education Council, the Dental Council of India, the Indian Nursing Council, the Medical Council of India, the National Council for Teacher Education, Central Council for Indian Medicine, the Pharmacy Council of India; (2) “Schedule” means schedule appended to this Act; . (aa) "Sponsoring body" in relation to a University established under this Act means :A (i) a Society registered under the Societies Registration Act, 1860 (Act no. 21 of1860); . (ii) any public trust registered under the Indian Trusts Act, 1882 ‘ . (Act no. 2 of 1882); -or (iii) a company registered under the Companies Act, 2013 (Act no. 8 of 20l3); - ‘ ' (ab) “Statutes”, “Ordinances” and “Regulations” means respectively, the Statutes, the Ordinances and the Regulations of the University for the time being in force; (ac) “Student” means a student enrolled with the University; (ad) “Teacher of the University” means Professors, Associate Professors, Assistant Professors, and such other persons as may be appointed for imparting education instructions, or conducting research in the University and are designated as Teachers by the Ordinances; (ae) “Treasurer”, “Registrar”, “Finance Officer”, "Controller of Examinations”, “Librarian” or, “Proctor” means v respectively the Treasurer, the Registrar, the Finance Officer, the Controller of Examinations, the Librarian or the Proctor of the University; (at) “UGC” means University Grants Commission established under section 4 of the University Grant Commission Act, 1956; (ag) "University" means a Private University established or incorporated under this Act. Conditions for the 3, The sponsoring body shall, for the purposes of establishing the University embl'smm °f under this Act, fulfill the following conditions, namely:- ' " ‘ the University (a) create a Permanent Endowment fund with minimum of Rs. 05 (five) crore; ‘ , (b) duly possess contiguous land of minimum twenty acres in urban areas or fifiy acres in rural areas earmarked for the University: Provided that, the ”sponsoring body shall not sell, transfer or lease out such land or any part thereof and also shall not use it for any , purpose other than the purposes mentioned ’ in this Act for the functioning of the University: Provided furflrer that such land shall not be mortgaged to any person other than a bank or financial institution established under any law for the time being in force for any purpose other than availing loan for establishing the University; ' l9 l_R.PH_Data 4 Vidhaika Folder (Adhiniynm72019)

\iccV A—kW 349It11VUT 1IJ1( 6 31W1, 2019 31

construct on land referred to in clause (b) buildings of at least twenty four thousand sq. metres carpet area, out of which minimum fifty per cent shall be utilized for academic and administrative purposes;

install equipments, computers, furniture, assets, infrastructural facilities other than building mentioned in clause (b) and other consumables and non consumables of minimum Rs. 2 (two) crore in offices and laboratories in the building referred to in clause (b); and an undertaking of procuring the computers, furniture, assets, infrastructural facilities [other than building mentioned in (b) above] and other consumables and non consumables of minimum Rs 6 (Six) crore in the next 5 years;

appoint Professors, Associate Professors and Assistant Professors as prescribed by the regulatory bodies and supporting staff members in every department or discipline. At least seventy five per cent of the regular teachers in each department/discipline shall be regular employees of the University;

purchase of books, periodicals and online resources worth Rs. ten lakh every year in the library:

Provided that in case of shortfall of expenditure to Rs ten lakh it shall be met in the next year;

arrange co-curricular Activities, extracurricular Activities, debates, competitions, quiz programs, sports, NSS and NCC for the students as per the standards of regulatory bodies;

conform to standards, conditions and Regulations set by UGC, AICTE, NCTE, BCI and other regulatory bodies established by the State Government or Central Government;

establish a provident fund for the employees and teachers of the University and to introduce other welfare schemes;

make the Statutes, Ordinances and Regulations for the administration and functioning of the University;

any arrangements made by the University shall not be inconsistent to the provisions of this Act and regulations of the regulatory bodies;

to ensure transparent functioning of the University and shall put the clearances obtained from the Regulatory Bodies in the public domain;

furnish information to the State Government as per format and periodicity required by the State Government;

comply with the norms set up by the State Government for common academic calendar, anti copying measures, admissions, examinations, degrees and certificates etc. ;

the transparent procedure and standard of admissions and fee structure in the University shall be decided and placed in the public domain before the start of the admission process. The last date of admission shall be as per the common academic calendar; -

Admission policy of foreign students shall be decided by the Executive Council of the University and shall be consistent with the standards laid down by the State Government and Regulatory Bodies;

follow the Common academic calendar as may be prescribed ; and

to undertake to fulfill such other conditions consistent with this Act as may be laid down by the State Government before the establishment of the University;

191_,RPH_Data 4 Vidhaika Folder (Adhiniyain 2019)

image30.tif

(C) (e) (f) (g) (h) (i) '(i) . (k) (1) (p) (q) (d). WWWW,,6W,2019 construct on land referred to in clause (b) buildings of at least twenty four thousand sq. metres carpet area, out of which minimum fifty per cent shall be utilized for academic and administrative purposes; install equipments, computers, fumiture, assets, infrastructural facilities other than building mentioned in clause (b) and other consumables and non ' consumables of minimum Rs. 2 (two) crore in offices and laboratories in the building referred to in clause (b); and an undertaking of procuring the computers, fumiture, assets, infrastructural facilities [other than building mentioned in (b) above] and other consumables and non consumables of ‘ minimum Rs 6 (Six) crore in the next 5 years; appoint Professors, Associate Professors and Assistant Professors as . prescribed by the regulatory bodies and supporting staff members in every department or discipline. At least seventy five per cent of the regular teachers in each department/discipline shall be regular employees of the University; ' purchase of books, periodicals and online resources wonh Rs. ten lakh every year in the library: 1 Provided that in case of shortfall of expenditure to Rs ten lakh it shall be met in the next year; arrange co-curricular Activities, extracurricular Activities, debates, competitions, quiz programs, sports, NSS and'NCC for the students as per the standards of regulatory bodies; conform to standards, conditions and Regulations set by UGC, AICTE, NCTE, BC] and other regulatory bodies established by the State Govemrnent or Central Govemment; establish a provident fund for the employees and teachers of the University and to introduce other welfare schemes; make the Statutes, Ordinances and Regulations for the administration and functioning of the University; any arrangements made by the University shall not be inconsistent to the provisions of this Act and regulations of the regulatory bodies; to ensure transparent functioning of the University and shall put the clearances obtained from the Regulatory Bodies in the public domain; furnish information to the State Government as per format and periodicity required by the State Government; comply with the norms set up by the State Government for common academic calendar, anti copying measures, admissions, examinations; degrees and certificates etc, ; the transparent procedure and standard of admissions and fee structure in the University shall be decided and placed in the public domain before the start of the admission process The last date of admission shall be as per the common academic calendar; ' Admission policy of foreign students shall be decided by the Executive Council of the University and shall be consistent with the standards laid down by the State Government and Regulatory Bodies ; follow the Common academic calendar as may be prescribed ; and to undertake to fulfill such other conditions consistent with this Act as may be laid down by the State Government before the establishment of the University; 191VRPH_Data 4 Vidhaika Folder (Adhiniyam 20l9)

32

\lccH Y1 31-R1111771 , 6 31-1 1, 2019

Submission of proposal for establishment of a new University

(r) to undertake neither to be involved nor to permit anyone to cause or promote anti-national activities inside the campus of the University or under the name of the University. In case of any such activity found in the University, it shall be considered as a major violation of the conditions of setting up the University and the Government may take action according to the provisions under this Act or any law for the time being in force.

4. (1) An application containing the proposal and the project report to establish a University shall be made by the sponsoring body to the State Government along with application fee as may be fixed by the State Government from time to time.

(2) The project report must contain the following particulars, namely:-

the details of the sponsoring body along with copies of its registration certificate and bye-laws duly certified by its competent authority; the information regarding financial resources of the sponsoring body along with audited accounts for the past three years; the name and location of the proposed University; the objectives of the University; the availability of land and details of buildings and infrastructure facilities, if the same already exists, and details of land, building and other infrastructure proposed to be owned or created;

(I) the nature and the type of programmes of study and research proposed to be undertaken by the University and their relevance to the development goals and employment needs of the State and phasing of such programmes over the first five years with course-wise enrolment targets; details of proposed academic facilities including teaching and non- teaching staff; facilities, courses of study and research proposed to be started; the experience and expertise in the concerned disciplines available with the sponsoring body; the details of plans for campus development such as construction of buildings, development of structural amenities and infrastructure facilities and procurement of equipment etc. tp be undertaken before the University starts functioning and phased programmes for the first five years; the phased outlays of capital expenditure proposed for the next five years;

(1) the sources of funds along with the scheme for mobilizing resources, the cost of capital thereto and the manner of repayment to Such sources; the system proposed to be 'followed for selecting students for admission to the courses of study at the University in the first year of operation; the system proposed to be followed for appointment of teachers and other employees in the University; whether the University proposes to undertake some programmes related to local needs. If so, the nature of specialized teaching, training or research Activities to be undertaken by the University so as to fulfil this objective;

(n) whether the University proposes to start some programmes for the benefit of farmers, women and local industries, if so, details thereof may be given;

191 RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image31.tif

32 WWWW,6W. 2019 (r) to undertake neither to be involved nor to permit anyone to cause or promote anti-national activities inside the campus of the University or ’ under the name of the University. In case of any such activity found in the University, it shall be considered as a major violation of the conditions of setting up the University and the (jovemment may take action according to the provisions under this Act or any law for the time being in force. Submission of 4. (1) An application containing the proposal and the project report to establish gmfifxxm on a University shall be made by the sponsoring body to the State Government along with new UnivefSiW application fee as may be fixed by the State Government from time to time. i (2) The project report must contain the following particulars, namely:- (a) the details of the sponsoring body along with copies of its registration certificate and bye-laws duly certified by its competent authority; (b) the information regarding financial resources of- the sponsoring body along with audited accounts for the past three years; (c) . the name and location of the proposed University; - , (d) the objectives of the University; (e) the availability of land and details of buildings and infrastructure facilities, if the same already exists, and details of land, building and \ other infrastructure proposed to be owned or created; (0 the nature and the type of programmes of study and research proposed to be undertaken by the University and their relevance to the development goals and employment needs of the State and phasing of such programmes over the first five years with course-wise enrolment targets; (g) details of proposed academic facilities including teaching and non- teaching staff; . (h) facilities, courses of study and research proposed to be started; (i) the experience and expertise in the concerned disciplines available with the sponsoring body; (j)' the details of plans for campus development such as construction of buildings, development V of structural amenities and infrastructure facilities and procurement of equipment etc. to be undertaken before the University starts functioning and phased programmes for the first five yearS; . '(k) the phased outlays of capital expenditure proposed for the next five years; i (l) the sources of funds along with the scheme for mobilizing resources, the , cost of capital thereto and the manner of repayment to such sources; (m) the system proposed to be ‘followed for selecting students for admission to the courses of study at the University in the first year of operation; (n) the system proposed to be followed for appointment of teachers and other employees in the University; ' (0) whether the University proposes to undertake some programmes related to local needs. If so, the nature of specialized teaching, training or research Activities to be undertaken by the University so as to fulfil this objective; ' (p) whether the University proposes to start some programmes for the benefit of farmers, women and local industries, if so, details thereof may be given; ‘ l9l_RPH_Data 4 Vidhaika Folder ( Adhiniyam_20l9)

ittlX• A-a-2T 31WflETRuf quid, 6 3111W1, 2019 33

details of play grounds and other facilities available or proposed to be created for games and sports and extra curricular activities like National Cadet Corps, National Service Scheme, Rover and Rangers

etc; the arrangements proposed to be made for academic excellence, if any; such other details as the sponsoring body may like to give; such other details as may be decided by the State Government from

time to time.

5. (1) The Higher Education Department of the State Government on receipt of the proposal along with the project report for establishment of a University shall constitute a committee consisting of

(a) one Vice-Chancellor of any of the State Universities established under the Uttar Pradesh State Universities Act, 1973;

()) one Professor @f a State University nominated by the State

Government; one officer to the Government of Uttar Pradesh not below the rank of Joint Secretary; one Officer of Finance and Account Services of Uttar Pradesh not below the rank of Joint Director; one officer nominated by the District Magistrate of the District concerned not below the rank of Sub-divisional Magistrate; one Registrar of a University established under the Uttar Pradesh State Universities Act, 1973 to be nominated by the State Government.

The committee shall consider the proposal and the project report together with the financial soundness and assets of the sponsoring body and its overall ability to

set up the proposed University. The committee, while considering the proposal and the project report may

call for such other information from the sponsoring body as it thinks proper for the

purpose. (4) The committee shall submit its report.to the Higher Education Department of the State Government within a period of three months from the date of its

constitution: Provided that if the Committee could not submit its report within the said three

months period for any sufficient reasons to be recorded in writing, it may submit its report to the Higher Education Department of the State Government within further one month or such period as may be permitted by the State Government:

Provided further that the inspections carried out by any committee constituted under the orders of the State Government before the commencement of this Act shall be deemed to be the inspection carried out by the evaluation committee constituted under

sub-section (1) above. 6. (1) After the receipt of the report of the committee constituted under

section 5, if the State Government is satisfied that it is proper to establish the University,

it may issue a 'Letter of Intent'.

The sponsoring body shall fulfill the requirements and conditions specified in section 3 and shall submit to the State Government compliance report thereof supported by an affidavit within a maximum period of two years from the date of issue of the letter

of intent. If the sponsoring body fails to comply with the provisions of section 3, the

State Government shall have power to withdraw the letter of intent issued to the

sponsoring body.

Evaluation of proposals by evaluation committee

Issuance of letter of intent and submission of compliance report by sponsoring body

191 RPH_Data 4 Vidhailca Folder (Adhiniyam_2019)

image32.tif

WWWW,SW,ZO19 (q) details of play grounds and other facilities available or proposed to be created for games and sports and extra curricular activities like National Cadet Corps, National Service Scheme, Rover and Rangers etc; . (r) the arrangements proposed to be made for academic excellence, if any; (5) such other details as the sponsoring body may like to give; (t) such other details as may be decided by the State Government from time to time. 5. (l) The Higher Education Department of the State Government on receipt of the proposal along with the project report for establishment of a University shall constitute a committee consisting of: — (a) one Vice-Chancellor of any of the State Universities established under the Uttar Pradesh State Universities Act, 1973; (b) one Professor (of a State University nominated by the State Government; (c). one officer to the Government of Uttar Pradesh not below the rank of Joint Secretary; . (d) one Officer of Finance and Account Services of Uttar Pradesh not below the rank of Joint Director; (e) one offiCer nominated by the District Magistrate of the District concemed not below the rank of Sub-divisional Magistrate; (0 one Registrar of a University established under the Uttar Pradesh State Universities Act, 1973 to be nominated by the State Government. (2) The committee shall consider the proposal and the project report together with the financial soundness and assets of the sponsoring body and its overall ability to set up the proposed University. (3) The committee, while considering the proposal and the project report may call for such other information fiom the sponsoring body as it thinks proper for the purpose. , (4) The committee shall submit its reportto the Higher Education Department of the State Government within a period of three months from the date of its constitution: Provided that if the Committee could not submit its report within the said three months period for any sufficient reasons to be recorded in writing, it may submit its report to the Higher Education Department of the State Government within further one month or such period as may be permitted by the State Government: Provided further that the inspections carried out by any committee constituted under the orders of the State Government before the commencement of this Act shall be deemed to be the inspection carried out by the evaluation committee constituted under sub- section (1) above. - 6. (1) After the receipt of the report of the committee constituted under section 5, if the State Government is satrst' ed that it is proper to establish the University, it may issue a 'Letter of Intent'. (2) The sponsoring body shall fulfill the requirements and conditions specified in section 3 and shall submit to the State Government compliance report thereof supported by an affidavit within a maximum period of two years from the date of issue of the letter of intent. (3) If the sponsoring body fails to comply with the provisions of section 3, the State Govemmenf shall have power to withdraw the letter of intent issued to the sponsoring body. l9lARPH_Data 4 Vidhaika Folder (Adhiniyam_2019) 33 Evaluation of proposals by evaluation committee Issuance of letter of intent and submission of compliance report by sponsoring body

34

•Icck. SItti 3M11117111 qui( 6 Wrer, 2019

Establishment or

incorporation of a

new University

Powers of the

University

7. (1) The State Government, if satisfied, after considering the compliance report submitted under section 3 that the sponsoring body has complied with the provisions of sub-section (1) of section 6, may, by a notification published in the Gazette permit the University to operate with such name and location as per the letter

of Intent. Names of the new Universities to be established under this Act shall be

included in Schedule-2 by amending this Act. After its establishment, the name of the newly established University shall

be mentioned by the State Government at the next serial number below the last University mentioned in the Scheduled-2 appended this Act.

Every University established or incorporated under this Act shall be a body corporate.

8. On the commencement of this Act the existing Universities enumerated in Schedule-I shall stand incorporated under this Act.

9. The University shall not admit any college or institution to the privilege of affiliation.

10. The objects of the University shall be to disseminate and ensure advancement of knowledge and skill for providing instructional, research and extension facilities in such branches of learning as it may deem fit and the University shall endeavour to provide to students and teachers the necessary atmosphere and facilities for the promotion of:-

innovations in education, leading to restructuring of courses, new methods of teaching, training and learning including online learning, blended learning, continuing education and such other modes and integrated and wholesome development of personality; studies in various disciplines; interdisciplinary studies; national integration, patriotism, secularism, social equity and inculcation of international understanding and ethics.

11. Subject to the guidelines and norms as prescribed by the Regulatory Bodies and the State Government from time to time the University shall have the powers, -

(a)

Incorporation of the

existing Universities

Prohibition for

affiliation

Objects of the

University

to provide for instruction in such branches of learning as the University may, from time to time, determine and to make provisions for research and for the advancement and dissemination of knowledge and skills; to provide for instruction in such branches of learning as the University may think fit and to make provisions for research and for the advancement and dissemination of knowledge; to honour educational stalwarts and persons of academic eminence with designation of professor Emeritus; to grant, subject to such conditions as the University may determine, diplomas or certificates to, and confer degrees or other academic distinctions on the basis of examinations, evaluation or any other method of testing of persons, and to withdraw any such diplomas, certificates, degrees or other academic distinctions for good and sufficient cause;

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image33.tif

34 Establishment or incorporation of a new University Incorporation of the existing Universities Prohibition for affiliation Objects of the University Powers of the University l9l_RPH_Data 4 Vidhaika Folder (Adhiniyam_20l 9) WWWW6W 2019 7. (l) The State Government, if satisfied, afier considering the compliance report submitted under section 3 that the sponsoring body has complied with the provisions of sub-section (1) of section 6, may, by a notification published in the Gazette permit the University to operate with such name and location as per the letter of Intent. ,4 (2) Names of the new Universities to be established under this Act shall be included in Schedule-2 by amending this Act. ' (3) Alter its establishment, the name of the newly established University shall be mentioned by the State Govermnent at the next serial number below the last University mentioned in the Scheduled—2 appended this Act. (4) Every University established or incorporated under this Act shall be a body corporate. ’ 8 On the commencement of this Act the existing Universities enumerated 1n Schedule-l shall stand incorporated under this Act. 9. The University shall not admit any college or institution to the privilege of affiliation. 10. The objects of the University shall be to disseminate and ensure advancement of knowledge and skill for providing instructional, research and extension facilities in such branches of learning as it may deem fit and the University shall endeavour to provide to students and teachers the necessary atmosphere and facilities I for the promotion of: - (a) innovations in education, leading to restructuring of courses, new methods of teaching, training and learning including online learning, blended learning, continuing education and such other modes and integrated and wholesome development of personality; (b) studies in various disciplines; (c) interdisciplinary studies; (d) national integration, patriotism, secularism social equity and inculcation of international understanding and ethics. 11. Subject to the guidelines and norms as prescribed by the Regulatory Bodies and the State Government from time to time the University shall have the powers, - ‘ ' . (a) to provide for instruction in such branches of learning as the University may, from time to time, determine and to make provisions for research and for the advancement and dissemination of knowledge and skills; (b) to provide for instruction in such branches of learning as the University may think fit and to make provisions for research and for the advancement and dissemination of knowledge; (c) to honour educational stalwarts and persons of academic eminence with designation of professor Emeritus; (d) to grant, subject to such conditions as the University may determine, diplomas or certificates to, and confer degrees or other academic distinctions on the basis of examinations, evaluation or any other method of testing of persons, and to withdraw any such diplomas, certificates, degrees or other academic distinctions for good and sufficient cause;

(e) to confer honorary degrees or other distinctions with prior approval of the State Government;

(f) to institute as per norms of Regulatory Authorities and State Government Directorships, Professorships, Associate Professorships, Assistant Professorships, and other teaching or academic posts required by the University and to make appointments for the same; to create administrative, ministerial and other posts and to make appointments thereto;

to appoint/engage persons of eminence, working in any other University or organization permanently or for a specified period;

to co-operate, collaborate or associate with any other University or Authority or Institution in India and abroad in such manner and for such purpose as the University may determine; to establish and maintain schools, centres, specialized laboratories in other units for research and instructions as are in the opinion of the University, necessary for the furtherance of its objects; to institute and award fellowships, scholarships, studentships, medals and prizes; to establish, maintain and supervise residences, hostels and promote the health and general welfare Activities for students and staff; to make provisions for research and consultancy, and for that purpose to enter into such arrangements with other institutions or bodies as the University may deem necessary; to establish a faculty, a department, a centre, or school, as the case may be, in accordance with the Act and Statutes; to determine standards in accordance with the State Government and other Regulatory Bodies for admissions into the University, which may include examination, evaluation or any other method of testing to ensure quality; to demand and receive payment of fees and other charges; to make special arrangements in respect of women and other disadvantaged students as the University may consider desirable; to regulate and enforce discipline among the employees and students of the University and take such disciplinary measures in this regards as may be deemed necessary by the University; to make arrangements for promoting the health and general welfare of the employees of the University; to receive donations and to acquire, hold and manage any property, movable or immovable for the welfare of the University; to ensure that no immovable property shall be disposed off or rights or title therein parted with or any liability created thereon, by any of the officers or authorities of the University, except after prior approval of the State Government; to appoint either on contract or otherwise, visiting professors emeritus professors, consultants, fellows, scholars, artists, course directors and such other persons who may contribute to the advancement of the objects of the University; to organize and to undertake extramural studies and extension service; and to do all such other acts and things as may be necessary, incidental or conducive to the attainment of all or any of the objects of the University.

\icvl 31711ITRuT Rif , 6 3111RI, 2019 35

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image34.tif

'Wmmmm,sm.2o19 35 (e) to confer honorary degrees or other distinctions with prior approval of the State Government; (f) to institute as per norms of Regulatory Authorities and State Government Directorships, Professorships, Associate Professorships, Assistant Professorships, and other teaching or academic posts required by the University and to make appointments for the same; (g) to create administrative, ministerial and other posts and to make ' appointments thereto; (11) ' ’ to appoint/engage persons of eminence, working in any other University or organization permanently or for a specified period; (i) to co-operate, collaborate or associate with any other University or Authority or Institution in India and abroad in such manner and for such purpose as the University may determine; 0) . to establish and maintain schools, centres, specialized laboratories in other units for research and instructions as are in the opinion of the University, necessary for the furtherance of its objects; ' (k) to institute and award fellowships, scholarships, studentships, medals and prizes; r (l) to establish, maintain and supervise residences, hostels and promote the health and general welfare Activities for students and staff; (m) to make provisions for research and consultancy, and for that purpose to enter into such arrangements with other institutions or bodies as the University may deem necessary; ‘ (n) to establish a faculty, a department, a centre, or school, as the case may be, in accordance with the Act and Statutes; (o) to determine standards in accordance with the State Government and other Regulatory Bodies for admissions into the University, which may include examination, evaluation or any other method of testing to ensure quality; (p) to demand and receive paymentof fees and other charges; (q) to make special arrangements in respect of women and other disadvantaged students as the University may Consider desirable; (r) to regulate and enforce discipline among the employees and students of the University andtake such disciplinary measures in this regards as may be deemed necessary by the University; (5) to make arrangements for promoting the health and general welfare of the employees of the University; ‘ I (t) to receive donations and to acquire, hold and manage any property, movable or immovable for the welfare of the University; (u) to ensure that no immovable property shall be disposed ofl" or rights or title therein parted with or any liability created thereon, by any of the officers or authorities of the University; except afler prior approval of the State Government; (v) to appoint either on contract or otherwise, visiting professors emeritus professors, consultants, fellows, scholars, artists, course directors and such' other persons who may contribute to the advancement of the objects of the University; (w) to organize and to undertake extramural studies and extension service; and (x) to do all such other acts and things as may be necessary, incidental or conducive to the attainment of all or any of the objects of the University. l9l_RPH_Data 4 Vidhaika Folder (Adhiniyam_20]9)

36 \lc-ci'( %i1 aistFuT 4i d, 6 3111-el, 2019

12. (1) Admissions to the different academic programmes shall be made in

accordance with the norms to be determined by the admissions committee in

accordance with the provisions of the Act, the Statutes, Ordinances made thereunder. The University shall ensure that the academic standards of the courses

offered by the University are in accordance with the guidelines of the Regulatory

Bodies. The teacher-student ratio shall be in accordance with the guidelines of the

Regulatory Bodies. 13. The University shall be open to persons of all sex and of whatever race,

creed, caste or class, and it shall not be lawful for the University to adopt to impose on any person any test whatsoever of his religious belief or profession in order to entitle

him to be admitted therein as an officer, a teacher, staff member, student, or to hold

any office therein or to graduate thereat: Provided that reservation in the posts and recruitment of the employees

and reservation of seats for admission in any course of study in the University for the

students belonging to the Scheduled Castes, Scheduled Tribes, Other Backward

Classes and Economically Weaker Sections of General Category of citizens shall be

regulated by the orders and guidelines of the State Government issued from time to

time. Officers of the 14. The following shall be the Officers of the University:- University

The Chancellor or the President

the Chancellor or the President;

the Pro-Chancellor or Vice-President;

the Vice-Chancellor;

the Pro-Vice-Chancellor;

the Registrar;

the Dean of Faculty;

the Dean of Students' Welfare;

the Director;

the Controller of Examinations;

the Chief Proctor;

the Finance Officer; and

such other Officers as may be declared by the Statutes to be the officers

of the University.

15. (1) The Chancellor/President shall be appointed by the Governing Body

for a period of five years by following such procedure and on such terms and

conditions as may be prescribed. The Chancellor/ President shall be the head of the University. The Chancellor/President shall preside over the meetings of the

Governing Body and convocation of the University. If, at any time, upon representation made or otherwise, and after making

such inquiry, as may be deemed necessary, the situation so warrants that the

continuance of the Chancellor/President is not in the interest of the University,

Governing Body, may, by majority decision ask the Chancellor/ President by an order,

in writing stating the reasons therefor, to relinquish his office before expiration of his

tenure from such date as may be specified in the order. In such case the

Pro-Chancellor/Vice-President shall preside over the meeting of the Governing Body:

Provided that before taking an action under this sub-section, the Chancellor/President shall be given an opportunity of being heard.

I91_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)

Admission and Standards

University open to all classes and creeds

image35.tif

36 Admission and Standards University open to all classes and creeds Officers of the University The Chancellor or thePresident Bodies. time. WWWW, same, 2019 12. (l) Admissions to the different academic programmes shall be made in accordance with the norms to be determined by the admissions committee in accordance with the provisions of the Act, the Statutes, Ordinances made thereunder. (2) The University shall ensure that the academic standards of the courses offered by the University are in accordance with the guidelines of the Regulatory (3) The teacher-student ratio shall be inaccordance with the guidelines of the Regulatory Bodies. 13. The University shall be open to persons of all sex and of whatever race, creed, caste or class, and it shall not be lawful for the University to adopt to impose on any person any test Whatsoever of his religious belief or profession 1n order to entitle him to be admitted therein as an officer, a teacher, staff member, student, or to hold any office therein or to graduate thereat: . Provided that reservation in the posts and recruitment of the employees and reservation of seats for admission in any course of study in the University for the students belonging to the Scheduled Castes, Scheduled Tribes, Other Backward Classes and Economically Weaker Sections of General Category of citizens shall be regulated by the orders and guidelines of the State Government issued fiom time to 14..The following shall be the Officers of the University:- (1) the Chancellor or the Piesident; (2) the Pro-Chancellor or Vice-President; ' (3) the Vice-Chancellor; I (4) the Pro-Vice-Chancellor; (5) the Registrar; (6) the Dean of Faculty; (7) the Dean of Students' Welfare; (8) the Director; (9) the Controller of Examinations; (10) the Chief Proctor; , (11) the Finance Officer; and ‘ " (12) such other Officers as may be declared by the Statutes to be the officers ‘ of the University. 15. (1) The Chancellor/President shall be appointed by the Governing Body —' for a period of five years by following such procedure and on such terms and 2 conditions as may be prescribed (2) The Chancellor/ President shall be the head of the University. (3) The Chancellor/President shall preside over the meetings of the Governing Body and convocation of the University. (4) If, at any time, upon representation made or otherwise, and after making ' such inquiry, as may be deemed necessary, the situation so warrants that the { continuance of the Chancellor/President is not in the interest of the University, GoVeming Body, may, by majority decision ask the Chancellor/ President by an order\ in writing stating the reasons therefor, to relinquish his office before expiration of his tenure from such date as may be specified in the order. In such case the Pro-ChancellorNice-President shall preside over the meeting of the Governing Body: Provided that before taking an action under this sub-section, the. Chancellor/President shall be given an opportunity of being heard. . I l9l_RPHVData 4 Vidhaika Fold (Adhiniyamg20l9)

\deer( 3MTETRuT , 6 &WWI, 2019 37

(5) The Chancellor/the President shall have the following powers, namely:-

to call for any information or record of the University;

to appoint the Vice-Chancellor under sub-section (1) of section 17

of this Act ;

to remove the Vice-Chancellor in accordance with the provisions of

this Act and Statutes made thereunder;

such other powers as may be prescribed.

(6) The Chancellor/President shall draw salary not exceeding double the amount

of salary of the Pro-Chancellor/the Vice-President of the University.

16. (1) The Pro-Chancellor/Vice-President shall be appointed by the

Chancellor/President with the approval of the Governing Body for a period of five years.

The Pro-Chancellor/Vice-President shall assist the Chancellor, President,

respectively in discharging his/her duties and preside at the convocation in his/her

absence.

The Pro-ChancellorNice-President may in writing under his hand addressed

to the Chancellor/President resign from his office.

(4) If, at any time, upon representation made or otherwise, and after making such

inquiry, as may be deemed necessary, the situation so warrants that the continuance of

the Pro-Chancellor/Vice-President is not in the interest of the University, the

Pro-Chancellor/Vice-President with the prior approval of the Governing Body, may, by

an order in writing stating the reasons therefor, ask the Pro-Chancellor/Vice-President to

relinquish his office before expiration of his tenure from such date as may be specified in

the order:

The Pro- Chancellor or Vice-President

Provided that before taking an action under this sub-section, the

Pro-Chancellor/Vice-President shall be given an opportunity of being heard.

The Pro-Chancellor/Vice-President shall draw salary which shall be less than

that of the Chancellor/President of the University.

17. (1) The Vice-Chancellor shall be appointed by the Chancellor/President with The Vice- prior approval of the Governing Body: Chancellor

Provided that a Vice-Chancellor shall be eligible for reappointment after the

expiry his/her term.

The Vice-Chancellor shall hold office for a period of five years or until he/she

attains the age of seventy years whichever is earlier.

If, at any time, upon representation made or otherwise, and after making such

inquiry, as may be deemed necessary, the situation so warrants that the continuance of

the Vice-Chancellor is not in the interest of the University, the Governing Body may, by

an order in writing stating the reasons therefor, ask the Vice-Chancellor to relinquish his

office from such date as may be specified in the order:

Provided that before taking an action under this sub-section, the Vice-Chancellor

shall be given an opportunity of being heard.

The Vice-Chancellor shall be the principal executive and academic officer of

the University and shall exercise general superintendence and control over the affairs

of the University and shall be the chairperson of the Executive Council and execute the

decisions of the Executive Council and other competent bodies and the State

Government made under the provisions of the Act and the Statutes, Ordinances and

Regulations made thereunder.

19I_RP1l_Dala 4 Vidhaika Folder (Adbiniyam_2019)

image36.tif

WWWW,6W, 2019 ' 37 (5) The Chancellor/the President shall have the following powers, namely:- (a) to call for any information or record of the University; (b) to appoint the Vice-Chancellor under sub-section (1) of section 17 of this Act; (c) to remove the Vice-Chancellor in accordance with the provisions of ‘ this Act and Statutes made thereunder; (d) such other powers as may be prescribed. (6) The Chancellor/President shall draw salary not exceeding double the amount of salary of the Pro- Chancellor/the Vice-President of the University. 16. (l) The Pro-ChancellorNice—President shall be appointed by the ThePro- Chancellor/President with the approval of the Goveming Body for a period of five years. Chmwum‘" Vice-President (2) The Pro-ChancellorN1ce-President shall assist the Chancellor, President respectively in discharging his/her duties and preside at the convocation in his/her absence. (3) The Pro-ChancellorNice—Presiderit may in writing under his hand addressed to the Chancellor/President resign from his office. ' a (4) If, at any time, upon representation made or otherwise, and alter making such inquiry, as may be deemed necessary, the situation so warrants that the continuance of ' the Pro-Chancellor/Vice—President is not in the interest of the University, the Pro-ChancellorNice-President with the prior approval of the Governing Body, may, by an order 1n writing stating the reasons therefor, ask the Pro-ChancellorN1ce-Presrdent to relinquish his office before expiration of his tenure fiom such date as may be specified 1n the order: Provided that before taking an action under this sub-section, the Pro-ChancellorNice-President shall be given an opportunity of being heard. (5) The Pro-Chancellor/Vice-President shall draw salary which shall be less than that of the Chancellor/President of the University. 17. (l) The Vice-Chancellor shall be appointed by the Chancellor/President with The Vice- prior approval of the Governing Body. Chancellor Provided that a Vice— Chancellor shall be eligible for reappointment afier the expiry his/her term. i (2) The Vice-Chancellor shall hold office for a period of five years or until he/she attains the age of seventy years whichever is earlier - (3) If, at any time, upon representation made or otherwise, and alter making such inquiry, as may be deemed necessary, the situation so warrants that the continuance of the Vice-Chancellor 15 not in the interest of the University, the Governing Body may, by an order in writing stating the reasons therefOr, ask the Vice-Chancellor to relinquish his office from. such date as may be specified in the order: ‘ _ Provided that before taking an action under this sub-section, the Vice-Chancellor shall be given an opportunity of being heard. (4) The Vice-Chancellor shall be the principal executive and academic officer of the University and shall exercise general superintendence and control over the affairs of the University and shall be the chairperson of the Executive Council and execute the decisions of the Executive Council and other competent bodies and the State Government made under the provisions of the Act and the Statutes, Ordinances and Regulations made thereunder. ' l9l_RPH_Dala 4 Vidhaika Folder (Adhiniyam_20]9)

38 k3c-c-1,C It4T 3171TtITPT . Ivi , 6 31-TRU, 2019

The Vice-Chancellor shall preside over the convocation of the University in

the absence of the Chancellor/President and the Pro-ChancellorNice-President. If in the opinion of the Vice-Chancellor, it is necessary to take immediate

action on any matter for which powers are conferred on any other authority by or under this Act, he may take such action as he deems necessary and shall at the earliest opportunity thereafter report his action to such officer or authority as would have in the ordinary course dealt with the matter within a period of thirty days:

Provided that if in the opinion of the concerned officer or authority such action should not have been taken by the Vice- Chancellor, then such case shall be referred to

the Chancellor/President, whose decision thereon shall be final. The Vice-Chancellor shall exercise such powers and perform such duties as

may be provided under this Act and the Statutes, Ordinances and Regulations made

thereunder. The Pro-Vice- 18. (1) The Pro-Vice- Chancellor shall be appointed by the Vice- Chancellor in

Chancellor such manner and shall exercise such powers and perform such functions as may be prescribed by the Statutes and provided in the Ordinances and regulations.

The Pro-Vice Chancellor appointed under sub-section (1) shall discharge his

duties in addition to his duties as a Professor. The Pro-Vice-Chancellor shall assist the Vice-Chancellor in discharging day

to day duties as and when required by the Vice- Chancellor. The Pro-Vice-Chancellor shall get honorarium of such amount as may be

determined by the Sponsoring Body. The Registrar 19. (1) The qualifications, term of office, conditions of service and procedure of

appointment of the Registrar shall be such as may be prescribed. The Registrar shall have the power to authenticate records on behalf of the

University. The Registrar shall be responsible for the due custody of records and the

common seal of the University. He shall be the a-officio Secretary of the Governing

Body, the Executive Council, the Academic Council and the Admissions Committee and every Selection Committee for appointment of teachers of the University, and shall be bound to place before these authorities all such information as may be necessary for transaction of their business. He shall also perform such other duties as may be prescribed by the Statutes, Ordinances and Regulations, and required, from time to time, by the Executive Council or the Vice-Chancellor but he shall not by virtue of this

sub-section, be entitled to vote. Dean of Faculty 20. Every Dean shall be appointed in such manner and shall exercise such

powers and perform such functions as may be prescribed. Finance Officer 21. (I) The Finance Officer shall be appointed in such manner and shall exercise

such powers and perform such functions as may be prescribed. (2) The Finance Officer shall be the a-officio Secretary of the Finance

Committee. Other Officers 22. The manner of appointment and powers and duties of the other officers of the

University including the Dean of Students' Welfare, Controller of Examinations and

Chief Proctor shall be such as may be prescribed. • Authorities of the

23. The following shall be the Authorities of the University:- University

the Governing Body ; the Executive Council; the Academic Council;

19I_RPH_Data 4 Vidhaika Folder (A4hiniyam_2019)

image37.tif

38 The Pro-Vice- Chancellor The Registrar Dean of Faculty Finance Officer Other Officers Authorities of the University WWWW.GW,ZO19 (5) The Vice-Chancellor shall preside over the convocation of the University in the absence of the Chancellor/President and the Pro—Chancellor/Vice-President. (6) If in the opinion of the Vice-Chancellor, it is necessary to take immediate action on any matter for which powers are conferred on any other authority by or under this Act, he may take such action as he ”deems necessary and shall at the earliest ' opportunity thereafier report his action to such officer or authority as would have in the ordinary course dealt with the matter within a period of thirty days : Provided that if in the opinion of the concerned officer or authority such action should not have been taken by the Vice- Chancellor, then such case shall be referred to the Chancellor/President, whose decision thereon shall befinal. (7) The Vice-Chancellor shall exercise such powers and perform such duties as ' may be provided under this Act and the Statutes, Ordinances and Regulations made thereunder. ' 18. (1) The Pro-Vice- Chancellor shall be appointed by the Vice- Chancellor in such manner and shall exercise such powers and perform such functions as may be prescribed by the Statutes and provided in the Ordinances and regulations. ' (2) The Pro-Vice Chancellor appointed under sub-section (1) shall discharge his duties in addition to his duties as a Professor. (3) The Pro-Vice-Chancellor shall assist the Vice-Chancellor in discharging day to day duties as and when required by the Vice— Chancellor. (4) The Pro-Vice-Chancellor shall get honorarium of such amount as may be determined by the Sponsoring Body. _ . l9. (1) The qualifications, term of office, conditions of service and procedure of appointment of the Registrar shall be such as may be prescribed (2) The Registrar shall have the power to authenticate records on behalf of the University. (3) The Registrar shall be responsible for the due custody of records and the common seal of the University. He shall be the ex-oflicio Secretary of the Governing Body, the Executive Council, the Academic Council and the Admissions Committee and every Selection Committee for appointment of teachers of the University, and shall be bound to place before these authorities all such information as may be necessary for transaction of their business. He shall also perform such other duties as may be prescribed by the Statutes, Ordinances and Regulations, and required, from time to time, by the Executive Council or the Vice-Chancellor but he shall not by virtue of this sub-section, be entitled to vote. 20. Every Dean shall be appointed in such manner and shall exercise such powers and perform such functions as may be prescribed. 21. (l) The Finance Officer shall be appointed in such manner and shall exercise such powers and perform such functions as may be prescribed. ' (2) The Finance Officer shall be the ex—oflicio Secremry of the Finance Committee. I 22. The manner of appointment and powers and duties of the other officers of the University including the Dean of Students' Welfare, Controller of Examinations and Chief Proctor shall be such as may be prescribed. . 23. The following shall be the Authorities of the University:- (1) the Governing Body ; (2) the Executive Council ; (3) the Academic Council; 191_an_nm 4 van-m Folder (ngow)

0-4141 31WITE/1T8 IluiC 6 3411i?t, 2019 39

the Finance Committee;

the Planning Board;

the Board of Faculties;

the Board of Studies;

the Admissions Committee;

the Examinations Committee; and

such other authorities as may be declared by the Statutes to be the

authorities of the University.

24. (1) The constitution of the Governing Body and the term of office of its members shall be such as may be prescribed.

The Governing Body shall meet once a year on the date to be fixed by the Chancellor/President and such meeting shall be called the annual meeting of the Governing Body:

Provided that the Chancellor/President may, whenever he thinks fit, and shall, upon a requisition in writing signed by not less than one fourth of the total membership of the Governing Body, convene a special meeting of the Governing

Body. Subject to provisions of this Act, the Governing Body shall Act as an

advisory Body of the University and have the following powers and functions,

namely:-

to review from time to time, the broad policies and programmes of the University and suggest measures for the working, improvement and development of the University; to consider and pass resolutions on the Annual Report and Annual accounts of the University and Audit Report of such accounts and furnish their views to the Executive Council;

to advise the President in respect of any matter which may be referred to it for advice; to perform such other functions as may be prescribed.

25. (1) The Executive Council shall be the principal executive body of the

University. The meeting of the Executive Council may be convened as may be

prescribed. The administration, management and control of the University and the

income thereof shall be vested with the Executive Council which shall control and

administer the property and funds of the University. The Executive Council, subject to the provisions of this Act, have the

following powers and duties:— to hold and control the property and funds of the University;

to acquire any movable or immovable property on behalf of the

University;

to make, amend or repeal Statutes and Ordinances;

to administer any funds placed at the disposal of the University

for specific purposes;

to approve the budget of the University;

to institute scholarships, fellowships, bursaries, medals and other

rewards in accordance with the Statutes and Ordinances;

to appoint Registrar, officers, teachers and employees of the

University and define the duties and conditions of their secvice;

The Governing Body

The Executive Council

19I_RPH_Data 4 Vidhaika Folder (Adhiniyare_2019)

image38.tif

WWWW,6W,ZO19 ' ' 39 (4) the Finance Committee ; (5)’ the Planning Board; ‘ (6) the Board of Faculties; . (7) the Board of Studies; (8) the Admissions Committee; (9) the Examinations Committee; and « (10) such other authorities as may be declared by the Statutes to be the authorities of the University. 24. (l) The constitution of the Governing Body and the term of office of its The Governing members shall be such as may be prescribed. 3“” (2) The Governing Body shall meet once a year on the date to be fixed by the Chancellor/President and such meeting shall be called the annual meeting of the Governing Body: Provided that the Chancellor/President may, whenever he thinks fit, and shall, upon a requisition in writing signed by not less than one fourth of the total ( membership of the Governing Body, convene a special meeting of the Governing Body. . (3) Subject to provisions of this Act, the Governing Body shall Act as an' t advisory Body of the University and have the following powers and fimctions, namely. - (a) to review from timeto time, the broad policies and programmes of ' the University and suggest measures for the working, improvement . and development of the University; (b) to consider and pass resolutions on the Annual Report and Annual accounts of the University and Audit Report of such accOunts and fumish their views to the Executive Council; (c) to advisethe President in respect of any matter which may be referred to it for advice; (d) to perform such other functions as may be prescribed. 25. (1) The Executive COuncil shall be the principal executive body of the he Exec-Hive University Council (2) The meeting of the Executive Council may be convened as may be prescribed. (3) The administration, management and control of the University and the ‘ income thereof shall be vested with the Executive Council which shall control and administer the property and funds of the University. (4) The Executive Council, subject to the provisions of this Act, have the ‘ following powers and duties:— (i) to hold and control the property and funds of the University; (ii) to acquire any movable or immovable property on behalf of the University; ' V (iii) to make, amend or repeal Statutes and Ordinances; (iv) to administer any funds placed at the disposal of the University , for specific purposes; (v) to approve the budget of the University; (vi) to institute scholarships, fellowships, bursaries, medals and other rewards in accordance with the Statutes and Ordinances; (vii) to appoint Registrant ofiicers, teachers and employees of the ' University and define the duties and conditions of their service; ‘ ~ l9l_RPH_Dm 4 Vitihaikn Folder (Adhiniyum_20|9)

40 ‘3cM ia1 31-fiTURuf , 6 aTIRTI, 2019

to fix the honorarium, emoluments, traveling and other allowances

of the examiners;

to direct the form and use of the common seal of the University;

to regulate and enforce discipline among members of the teaching, administrative and other staff of the University in accordance with the Statutes and Ordinances;

to manage and regulate the finances, accounts, investments, property and all other administrative affairs of the University;

to invest any money belonging to the University including endowed property;

to provide the buildings, premises, -furniture, equipments, apparatus and other means needed for carrying on the work of the

University;

to enter into, vary, carry out, and cancel contract on behalf of the

University;

to regulate• and determine all other matters concerning the University in accordance with this Act, the Statutes, the Ordinances and the Regulations.

(5) Every decision of the Executive Council shall be informed by the reasons

therefor.

The Academic Council

(6) The Vice-Chancellor shall be the Chairperson of the Executive Council, which shall consist of the following other members, namely :—

. three members to be nominated by the Governing Body;

two eminent educationists nominated by the President;

one officer of the State Government not below the rank of Joint Secretary to the Government of Uttar Pradesh;

one Professor and one Associate Professor of the University in order of seniority on rotation basis for a period of one year;

one educationist not below the rank of Associate Professor from a panel of three names to be approved by the State Government, for which the University shall submit a list of three names of eminent educationists;

the Registrar who shall be a-officio Member Secretary;

the Finance Officer shall have the right to speak in and otherwise to take part in the proceedings of the Executive Council but shall not be entitled to vote;

Quorum of the meeting of the Executive Council shall not be less than six

members.

Decisions at any meeting of the Executive Council shall be taken by majority of the members present at such meeting:

Provided that, in case of tie in any proposal, the proposal having support of the Vice-Chancellor shall prevail.

26. (1) The Academic Council shall be the principal academic body of the University and shall subject to the provisions of the Statutes, the Ordinances and Regulations, co-ordinate and exercise general supervision over the academic policies of the University. •

(2) The constitution of the Academic Council, the term of office of its members and its powers and functions shall be such as may be prescribed.

191_RPH_Data 4 Vidhaika Fold - (Adhiniyam_2019)

image39.tif

Wmmfiwmem, 2019 ___’______________’———-——— (viii) to fix the honorarium, emoluments, traveling and other allowances of the examiners; _ (ix) to direct the form and use of the common seal of the University; (x) to regulate and enforce discipline among members of the teaching, administrative and other staff of the University in accordance with the Statutes and Ordinances; (xi) to manage and regulate the finances, accounts, investments, property and all other administrative affairs of the University; (xii) to invest any money belonging to the University including endowed property; ' (xiii) ' to provide the buildings, premises, -fumiture, equipments, apparatus and other means needed for carrying on the work of the University; (xiv) to enter into, vary, carry out, and cancel contract on behalf of the University; (xv) to regulate and determine all other matters concerning the , University in accordance with this Act, the Statutes, the Ordinances and the Regulations. (5) Every decision of the Executive Council shall be informed by the reasons therefor. (6) The Vice-Chancellor shall be the Chairperson of the Executive Council, which shall consist of the following other members, namely :— ' , (i) three members to be nominated by the Governing Body; (ii) two eminent educationists nominated by the President; (iii) one officer of the .State Government not below the rank of Joint Secretary to the Government of Uttar Pradesh; (iv) one Professor and one Associate Professor of the University in order of seniority on rotation basis for a period of one year; (v) one educationist not below the rank of Associate Professor from a panel of three names to be approved by the State Government, for which the University shall submit a list of three names of eminent educationists; (vi) the Registrar who shall be ax—oflicia Member Secretary; (vii) the Finance Officer shall have the right to speak in and otherwise to take part in the proceedings of the Executive Council but shall not be entitled to vote; (7) Quorum of the meeting of the Executive Council shall not be less than six members. " (8) Decisions at any meeting of the Executive Council shall be taken by majority of the members present at such meeting: Provided that, in case of tie in any proposal, the proposal having support of the Vice-Chancellor shall prevail. The Academic 26. (l) The Academic Council shall be the principal academic body of the C°“"°" University and shall subject to the provisions of the Statutes, the Ordinances and Regulations, co-ordinate and exercise general supervision over the academic policies of the University. ' (2) The constitution of the Academic Council, the term of office of its members and its powers and functions shall be such as may be prescribed. - I91_RPHVData 4 Vidhaika Fold ’ (Adhiniyam_2019)

cr1•4 41 3R11tTRui Jul , 6 3PTF1, 2019

aThetEinance ;Comnattee •

27. (1) The Finance Committee shall be the principal financial body of the University to take care of the financial matters.

(2) The constitution, powers and functions of the Finance 'Committee shall be such, as may be prescribed.

28. (1) The Planning Board shall be the principal planning body of the UniverSity. The Board shall ensure that the infrastructure and academic support system meets the norms of the University Grants Commission and other Regulatory Bodies.

(2) The constitution, of the Planning Board, term of office of its members and its powers and functions shall be such as may be prescribed.

29. The constitution, powers and functions of the Board of Facilities, ithe Admissions Committee, the Examinations Committee and of such other authotaties ofithe University which may be declared by the Statutes to be authorities of the UniverSity, Shah be such as may be prescribed.

30. A person shall be disqualified for being a member of any of the authorities or bodies of the University, if he/she—

(1 )

is of unsound mind and stands so declared by a competenticourt;

is an undischarged insolvent;

has been convicted of any offence involving moral turpitude;

(4). has been punished for indulging in or promoting unfair 'practice un the conduct of any examination, in any form, anywhere;

has any profit motive from University except salary or any other authorised emoluments;

applies University fund for his personal use.

31. No decision, Act or proceeding of any authority or body of the University shall be invalid merely by reason of any vacancy or defect in the constitution thereof.

32. Any vacancy occurred in the membership of any authority or body of the University due to death, resignation or removal of a member or due to 'Change icif capaCity in which he was appointed or nominated, shall be filled up as early as possible lby the person or the body who had appointed or nominated such a member:

Provided that the person appointed or nominated as a member of an authority or body of the University on an emergent vacancy, shall remain member of such mithofiWor body, for only the remaining period of the member, in whose place he is ;apprinited or

nominated.

33. The authorities or officers of the University May constitute :such comnfittees or Comniittets

sub-committee with such terms of reference, in conformity with the Act, Statutes, Ordinances and Regulations, as may be necessary for specific tasks to be performed lby such committees. The constitution of such committees or sub-committee and thiir duties shall be such as may be determined by the authority or officer constituting the Comniittee

or sub-committee.

ThelPlanrilog :Board

1BoardicifiFacalw, iBoantIrdeStddies, adnasaions Comniittee, Exaniinations Comniittee:and (otheriAuthotities orfithelUtiivera4y

IDisqualiftcation tfonmeniberghip cdfaabody

Wacandieanotto anvalidatetthe mnxectliogsaif t.almoarahoi-dycor ibodyairdhe Ildriiverady

lEillingarxdf (emergent wacanaies

19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image40.tif

WWWW,6W2M9 27. (1) The Finance Committee shall be the principal financial rbody to’flthe University to take care of the financial matters. (2) The constitution, powers and functions of the Finance Committee shall the such, as may be prescribed. 28. (l) The Flaming Board shall be the principal planning body of the University. The Board shall ensure that the infrastructure and academic support system meets tthe norms of the University Grants Commission and other Regulatory Bodies. (2) The constitution, of the Flaming Board, term of office of its members and its powers and functions shall be such as may be prescribed. 29. The constitution, powers and functions of the Board of 'Eacu‘ltiies, the Admissions Committee, the Examinations Committee and of such other authorities (oftthe University which may be declared by the Statutes to be authorities of the University, shall be such as may be prescribed. V 30. A, person shall be disqualified for being a member of any of the :authonit'ies (or bodies of the University, if-he/she— (l) is of unsound mind and stands so declared by a competent court; (2) is an undischarged insolvent; (3) has been convicted of any offence involving moral mmp'itude; (4). has been punished for indulging in or promoting tinfair practice iin the conduct of any examination, in any form, anywhere; (5) has any profit motive from University except salary or :any «other authorised emoluments; (6) applies University fund for his personal use. 31. No decision, Act or proceeding of any authority or body ofthe University ss'ha‘ll [be invalid merely by reason of any vacancy or defect in the constitution thereof. 32. Any vacancy occurred in the membership of any authority or body (of tfhe University due to death, resignation or removal of a member or due to change «o’flcapacity in which he was appointed or nominated, shall be filled up as early as possible lby the person or the body who had appointed or nominated such a member: Provided that the person appointed or nominated as a member ofan authority (01' body of the University on an emergent vacancy, shall remain member ofzsuc’h authofiitytor body, for only the remaining period of the member, in whose place he is appointed (or nominated. ' 33. The authorities or ofiioers of the University may constitute :such committees or sub-committee with such terms of reference, in conformity with the Act, Statutes, Ordinances and Regulations, as may be necessary for specific tasks to be performed [by such committees. The constitution of such committees or sub-conunittee and their duties shall be such as may be determined by the authority or ofiicer constituting the (Committee or sub-committee. l9l_RPHVD2ta 4 Vidhaika Folder (Adhiniyam_20]9) ilThe lEinance {Committee 'vThelElanriing ZBoar'd lBoardtofiEaciilty, iBoardtdflStu‘d ies. lA'dm'iss'ions (Committee, Examinations (Gomm' itteeian'd (other/Authorities (o'flthclUniversity ' “Disqualification {forlmenibertliip to’fzalbody \Vacaneiesmottto iinvtilidatetflte [proceedingo’f zanyzauthorityzor . lboliyuilithe “University lEillingiuptof tetnergent ‘ \vacancies I (Gomniittm

42 313119Telf , 6 3111€1, 2019

Power to make statutes

34i(1))The. first Statutes. of the Universities established or incorporated under

this; Act shall' be made by. the Executive Council and shall be submitted to the State

G'overnmentforithapprovat. (?)) The Government shall consider the First Statutes submitted by the

UhiersitYyandishallIapproveit within three months from the date of its receipt. If the State:Government:does; not approve or communicate to the University the objections thereorn witliiin the tiine mentioned above, statutes so submitted shall be deemed to be

approved!. (i3))Stibjecttmthe provisions of this Act the Statutes may provide for all or any

ofilliefollOWingmatters,,namely)- (a)) the constitution; powers and functions of the authorities of the

Illiihrersity,,, as; may be constituted from time to time;

(0)) theappoihtment and continuance in office of the members of the said authorities) filling of vacancies of members of the said authorities, filling,ofivacancies of members and all other matters relating to those

authorities; Mr. which it may be necessary to provide;

(a)) the appointment, powers and functions of •the officers of the

University' and their emoluments;

(.0)) the appointment of teachers of the University and other academic and

adinihrstrative: staff and their emoluments;

(e)) the appointment of teachers and other academic and administrative staffiworking• in the University or Institution for specific period for

undertakingajOint project;

the conditions. of service of employees including provisions for

retirement- benefits, insurance and provident fund, the manner of temilnatibm of their service and the disciplinary matters;

theprinoMies.goveming seniority of service of employees;

(()) the procedure fOr settlement of disputes between employees or students; and the: University;

(i)) theprocedize: for appeal to the Executive Council by any employee or student against the action of any officer or other authority of the

luniVersity;

()i theconferment of honorary degrees;

00) the withdrawal of degree, diploma, certificate and other academic

distinctions;!

(I)) the institution' of fellowships, scholarships, studentships, medals and

priies;;

(in)) themaintenance of discipline among the students;

(n)) the establishment and abolition of Departments, Centers and other

institutions. etc, within the campus of the University; (0)) the delegation of powers vested in the authorities or officers. of the

EJniVersity;; and

(09) .alllothermafters, as per this Act or as may be prescribed.

(4)) the ExecutiVe Council shall not make, amend or repeal any Statute affecting; the powers; or constitution of any authority of the University until such autliorityy has; beem giVert am opportunity of expressing an opinion in writing on the proposedlchanges; and any, opinion so expressed shall be considered by the Executive Council!.

a

191_RPH_Data41Willitileafolderi(A'dhifiikami 2019))

image41.tif

42 Power to make statutes caram- 3121mm we, 6 m. 2019 3?:3,((l=))lihe'firstStatutes of the Universities established or incorporated under thi'sua‘cttshallibe:made by: the Executive Council and shall be submitted to the State Government:fon'itSsapproval;. (24)) The: Government shall consider the First Statutes submitted by the Uhii/ersitygandishalllapprovezit within three months from the date of its receipt. If the Stateervemment‘doesx not approve or communicate to the University the objections thereoniwithintthe:time:mentioned above, statutes so submitted shall be deemed to be approvedl. I , 03))Sirliject-toithe:provisions of this Act the Statutes may provide for all or any oflthe:follbwii1ggmatters;.namely:- (‘31)) the: constitution; powers and functions of the authorities of the Uhi‘vensitysasx may be constituted from time to time; ‘ ‘ (115)) therappoi'ntment and continuance in office of the members of the said authorities; filling of vacancies of members of the said authorities, filli'nggofi’vacancies of members and all other matters relating to those authorities fc'm‘ which it may be necessary to provide; (’c)) the: appointment; powers and functions of the officers of the UniVersity'andl their emoluments; ' _ (6)) the: appointment of teachers of the University and other academic and administrative staff and their emoluments; I ((6)) the-appointment of teachers and other academic and administrative stafifi'wortl'tingx in the University or Institution for specific period for und'ertakingna joint project; (vi)) the: conditions of service of employees including provisions for retirement? benefits, insurance and provident fund, the manner of tenninatiomof their service and the disciplinary matters; 6g» the-principlesgoverning seniority of service of employees; (W flier procedure, for settlement of disputes between employees or students; and; the: University; (ti)) flie3proced'ure: for appeal to the Executive Council by any employee or - student» against the action of any officer or other authority of the ' University; ' GD) tl'te'conferment of honorary degrees; (It) the: withdrawall of degree, diploma, certificate and other academic distinctions; (Il)) . die:instituti'om of fellowships, scholarships, studentships, medals and prizes; ' (-3113) thermai'ntenance of discipline among the students; 61)) the» establishment and abolition of Departments, Centers and other institutions etc; within the campus of the University; (bi) the delegation of powers vested in the authorities or officers. of the [UhiiIersityvuand (12)) .alllotfienmatters, as per this Act or as may be prescribed. (’49) "Elie: Executive Council shall not make, amend or repeal any Statute affecting), the: powers; on constitution of any authority of the University‘until such authority/ hastbeent giIvent am opportunity of expressing an opinion in writing on the Egfisiolchangeszandlanygopi'nion so expressed shall be considered by the Executive or .. l9l.RPH_Da:al4l VifllinilirFéld'erKA’dhiniyaml 2019))

dcyW Tra7T 3T-iiNNW 1i1 6 311111., 2019 43

35. Subject to the provisions of this Act and the Statutes, the Ordinances shall Power to make be made by the Executive Council which may provide for all or any of the following Ordinances

matters, namely:-

the admission of students to the University and their enrolment as such;

the courses of study to be laid down for all degrees, diplomas and

certificates of the University;

the medium of instruction and examinations;

the award of degrees, diplomas, certificates and other academic

distinctions, the qualifications for the same and the measures to be

taken relating to the granting and obtaining of the same;

the fees to be charged for courses of study in the University and for admissions to the examinations, degrees, diplomas and certificates of

the University;

the conditions for the award of fellowships, scholarships, studentships,

medals and prizes;

the conduct of examinations, including the term of office and manner of appointment and the duties of examining bodies, examiners and

moderators;

(h) the conditions of residence of the students of the University;

(i) the special arrangements, if any, which may be made for the residence, discipline and teaching of women students and prescribing of special

courses of studies for them within the University;

(j) the appointment and emoluments of employees other than those for

whom provision has been made in the Statutes;

the establishment of Centre of Studies, Board of Studies, Interdisciplinary Studies, Special Centers, Specialized Laboratories and

other Committees;

the manner of co-operation and collaboration with other Universities

and authorities including professional bodies or associations;

the creation, composition and functions of any other body which is considered necessary for improving the academic stature of the

University;

the remuneration to be paid to the examiners, moderators, invigilators

and tabulators; and

such other terms and conditions of service of teachers and other

academic staff as are not prescribed by the Statutes.

36. (1) The Annual Report of the University shall be prepared under the direction of the Executive Council and shall be submitted to the Governing Body on such date as may be prescribed and the Governing Body shall consider the report in its annual

meeting. (2) The Governing Body shall submit its comments on the Annual Report to the

Executive Council for its considerations.

37. (1) The Annual Accounts and Balance Sheet of the University shall be

prepared under the directions of the Executive Council/ad. d• shall, once at least every

year and at intervals of not more than fifteen months, be audited by an experienced and

qualified firm of Chartered Accountants of repute.

(2) A copy of the Annual Accounts, together with the audit report thereon, shall

be submitted to the Governing Body and the Chancellor/President along with the

observations of the Executive Council.

(k)

(I)

(m)

Annual Report

Annual Accounts

19I_RPH_Data 4 Vidhaika Folder (Adbiniyam_2019)

image42.tif

Wmmwmam, 2019 - 43 _—__’__—_—————————— 35. Subject to the provisions of this Act and the Statutes, the Ordinances shall P0W_6”° make be made by the Executive Council which may provide for all or any of the following 0mmm°es matters, namely:- . (a) the admission of students to the University and their enrolment as such; (b) the courses of study to be laid down for all degrees, diplomas and certificates of the University; (c) the medium of instruction and examinations; (d) the award of degrees, diplomas, certificates and other academic distinctions, the qualifications for the same and the measures to be taken relating to the granting and obtaining of the same; '(e) the fees to be charged for courses of study in the University and for admissions to the examinations, degrees, diplomas and certificates of the University; (f) the conditions for the award of fellowships, scholarships, studentships, medals and prizes; ' _ _ (g) the condiict of examinations, including the term of office and marmer ‘ ,, of appointment and the duties' of examining bodies, examiners, and moderators; ' ’ - ' (h) the conditions of residence of the students of the University; (i) the special arrangements, if any, which may be made for the residence, discipline and teaching of women students and prescribing of special courses of studies for them within the University; ' (j) the appointment and emoluments of employees other than those for whom provision has been made in the Statutes; (k) the establishment of Centre of Studies, Board of Studies, Interdisciplinary Studies, Special Centers, Specialized Laboratories and other Committees; (1) the manner of co—operation and collaboration with other- Universities and authorities including professional bodies or associations; ' (m) the creation, composition and functions of any other body which is considered necessary for improving the academic stature of the University; , (n) the remuneration to be paid to the examiners, moderators, invigilators and tabulators; and , i (0) such other terms and conditions of service of teachers and other academic staff as are not prescribed by the Statutes. 36. (l) The Annual Report of the University shall be prepared under the direction Annual R690" of the Executive Council and shall be submitted to the Governing Body on such date as ' may be prescribed and the Governing Body shall consider the report in its annual meeting. (2) The Governing Body shall submit its comments on the Annual Report to the Executive Council for its considerations. . . 37. (l) The Annual Accounts and Balance Sheet of the University shall be Annual prepared under the directions of the Executive Council {and .shall, once at least every ”cm“ year and at intervals of not more than fifteen months, be audited by an experienced and qualified firm of Chartered Accountants of repute. (2) A copy of the Annual Accounts, together with the audit report thereon, shall be submitted to the Goveming Body and the Chancellor/President along with the j observations of the Executive Council. i914iu>Hme 4 Vidltaika Folder (Adhiniyam_20]9)

44

sict-N cth 31Rilt•TRuf wl d, 6 3179?1, 2019

Conditions of

service of

employees

Right to Appeal

Employees .

Provident Fund

and Pensions

Mode of proof of

University

records

!Publication of

Statues,

Ordinances and

Regulations

Pennanent

Endowment

Fund

(3) Any observations made by the President on the annual accounts shall be

brought to the notice of the Governing Body and the Executive Council and the

observations, if any, shall, after review by the Executive Council, be submitted to the

Chancellor/President and shall be put in the public domain.

38. (1) Every employee of the University shall be appointed/engaged as per the

provisions of this Act and Statutes made thereunder.

Any dispute arising between the University and any of the regular employees,

shall be referred to the Vice-Chancellor who shall decide the dispute after affording an

opportunity to the employee within three months from the- date of receipt of its

reference. Any dispute in respect of any etftployee engaged temporarily or on ad-hoc or

part time or casual basis shall be heard and decided by the Vice-Chancellor.

39. (1) An aggrieved person may prefer an appeal to the Chancellor/President

against any decision of an officer or authority of the University within a period of three

months from the date of receipt of such decision:

Provided that the Chancellor/President shall have power to condone the delay

if he is satisfied that the appellant for sufficient reasons could not have preferred this

appeal within the stipulated time.

(2) Any decision taken by the Chancellor/President in such an appeal shall be

final.

40. The University shall constitute for the benefit of its employees such pension

or welfare schemes or Provident Fund or provide such insurance schemes as it may

deem fit in such manner and subject to such conditions as may be decided by the

Executive Council.

41. A copy of any receipt, application, notice, proceeding, resolution of any

authority or Committee of the University or other documents in possession of the

University, if certified by the Registrar, shall be received as prima-facie evidence of the

such receipt, applications, notice, order, proceeding or resolution, documents or the

existence of entry in the register and shall be admitted as evidence of the matters and

transactions therein where the original would, if produced, have been admissible in

evidence.

42. Every Statute, Ordinances and Regulations made under this Act shall be

published by the University.

43. (1) The Sponsoring body shall establish a permanent Endowment Fund of at

least Its. 5 (five) crore.

The Endowment fund shall be used as security deposit to ensure that the

University complies with the provisions of this Act and functions as per provisions of

this Act, the Statutes, the Ordinances and the Regulations. The State Government shall

have the powers to forfeit, a part or whole of the Endowment Fund, in case the

University or the Sponsoring Body contravenes the provisions of this Act, the Statutes,

the Ordinances or the Regulations made thereunder.

The University may utilize the income from Endowment Fund for the

development of infrastructures of the University or for meeting the recurring

expenditure of the University.

The amount of Endowment Fund shall be invested in such instruments as the

State Government may prescribe by rules and shall be kept invested until the dissolution

of the University.

9I_RPH_Data 4 Vidhaika Fold. (Adhiniyam_2019)

image43.tif

44‘ Wmmwmtmjmg Conditions of service of employees Right to Appeal Employees . Provident Fund and Pensions Mode of proof of University records Publication of Statues, Ordinances and Regulations Permanent Endowment Fund (3) Any observations made by the President on the annual accounts shall be brought to the notice'of the Governing Body and the Executive Council and the observations, if any, shall, afier review by the Executive Council, be submitted to the Chancellor/President and shall be put in the public domain. 38. (1) Every employee of the University shall be appointed/engaged as per the provisions of this Act and Statutes made thereunder. (2) Any dispute arising between the University and any of the regular employees, shall be referred to the Vice-Chancellor who shall decide the dispute afier affording an opportunity to the employee within three months from the" date of receipt of its reference. (3) Any dispute 1n respect of any employee engaged temporarily or on ad— hoc or part time or casual basis shall be heard and decided by the Vice-Chancellor. 39. (1) An aggrieved person may prefer an appeal to the Chancellor/President against any decision of an officer or authority of the University within a period of three months from the date of recerpt of such decision: Provided that the Chancellor/President shall have power to condone the delay if he 15 satisfied that the appellant for sufficient reasons could not have preferred- -his appeal within the stipulated time. (2) Any decision taken by the Chancellor/President in such an appeal shall be final. _ ’ . 40. The University shall constitute for the benefit of its employees such pension or welfare schemes or Provident Fund or provide such insurance schemes as it may ' deem fit in such manner and subject to such conditions as may be decided by the Executive Council. 41. A copy of any receipt, application, notice, proceeding, resolution of any authority or Committee of the University or other documents in possession of the University, if certified by the Registrar, shall be received as prima-facie evidence of the such receipt, applications, notice, order, proceeding or resolution, documents or the existence of entry in the register and shall be admitted as evidence of the matters and transactions therein where the original would, if produced, have been admissible in ' evidence. 42. Every Statute, Ordinances and Regulations made under this Act shall be published by the University. ‘ 43. (1) The Sponsoring body shall establish a permanent Endowment Fund of at least Rs. 5 (five) crore. (2) The Endowment fund shall be used as security'deposit to ensure that the University complies with the provisions of this Act and fimctions as per provisions of this Act, the Statutes, the Ordinances and the Regulations. The State Government shall .have the powers to forfeit, a part or whole of the Endowment Fund, in case the University or the Sponsoring Body contravenes the provisions of this Act, the Statutes, the Ordinances or the Regulations made thereunder. (3) The University may utilize the income from Endowment Fund for the development of infrastructures of the University or for meeting the recurring expenditure of the University. (4) The amount of Endowment Fund shall be invested' in such instruments as the State Government may prescribe by rules and shall be kept invested until the dissolution of the University. l9l_RPH'Data 4 Vidhaika Fold: {Adhiniyum_2019)

Niatt A—kW 31311tITRuf hlotd, 6 31Wf, 2019

(5) In case of investment in long term security, and in case of deposit in the interest bearing Personal Deposit Account in the Government Treasury, deposit shall be made with the condition that the amount shall not be withdrawn or utilized without the prior permission of the State Government.

44. (1) The University shall establish a general fund to which the following amount shall be credited, namely:-

all fees which may be charged by the University; all sums received from any other sources; all contributions made by the Society ; and all contributions made in this behalf by any other person or bodies which are not prohibited by any law for the time being in force.

(2) The money credited to the general fund shall be applied to meet all the recurring expenditures of the University. •

45. (I) The University shall also establish a development fimd to which the following moneys shall be credited, namely:—

development fees, which may be charged from students; all sums received from other sources for the purpose of the development of the University; all contributions made by the Sponsoring Body; all contributions made in this behalf bj, any other person or bodies which are not prohibited by any law for the time being' in force; and all incomes received from the permanent endowment fund.

(2) The moneys credited to the development fund from time to time shall be utilized for the development of the University.

46. All funds e§tablished under this Act shall subject to general supervision and control of the Executive Council and be regulated and maintained in such manner as

may be prescribed. 47. The University shall not be eligible for any grants in aid or any financial

assistance from the State Government or any other body or Corporation owned and

controlled by the State Government.

48. The fee structure for all purposes shall be decided by the Executive Council provided that the University shall not charge any fee from its students in excess of what is required under any law of the State Government at the time being in force or as fixed by the Regulatory Bodies and the fees structure shall be put in public domain.

49. Within a period of five years from commencement of programmes, the University shall obtain NAAC and other such accreditations as may be prescribed by the State Government from time to time. It shall also obtain certification/accreditation from such other Regulating Bodies which are connected with the courses taken up by the University. It shall inform the State Government about the grade provided to the University. The University shall ensure renewal of such accreditation from time to time.

50. The convocation of the University shall be held in every academic year in

the manner as may be prescribed by the Statutes, the Ordinances and the Regulations for conferring degrees, diplomas or for any other purpose.

51. (1) To ensure the compliance of the provisions of this Act, Statutes, Ordinances and Regulations made thereunder, the Uttar Pradesh State Higher Education Councilstall be the nodal agency.

General Fund

Development

Fund

Maintenance of

Funds

The University

shall be self financed

Fees

Accreditation of the University

Convocation

The Uttar Pradesh

Higher Education Council shall be the nodal agency for Private Universities

19I_RPH_Data 4 11(idhaika Folder (Adhiniyam_2019)

image44.tif

WWWW, 6 W, 2019 (5) In case of investment in long term security, and in case of deposit in the interest bearing Personal Deposit Account in the Government Treasury, deposit shall be made with the condition that the amount shall not be withdrawn or utilized without the prior permission of the State Government. 44. (1) The University shall establish a general fund to which the following amount shall be credited, namely:- (a) all fees which may be charged by the University; (b) all sums received from any other sources; (c) all contributions made by the Society ; and (d) all contributions made in this behalf by any other person or bodies which are not prohibited by any law for the time being 1n force. (2) The money credited to the general fund shall be applied to meet all the recurring expenditures of the University. ‘45. (l) The University shall also establish a development fund to which the following moneys shall be credited, namely:— (a) development'fees, which may be charged from students; (b) all sums received from other sources for. the purpose of the development of the University; (c) all contributions made by the Sponsoring Body; (d) all contributions made' 1n this behalf by any other person or bodies which are not prohibited by any law for the time being” in force; and (e) all incomes received from the permanent endowment fund. (2) The moneys credited to the development fund fi'om time to time shall be utilized for the development of the University. 46 All funds established under this Act shall subject to general supervision and control of the Executive Council and be regulated and maintained 1n such manner as may be prescribed. . 47. The University shall not be eligible for any grants in aid or any financial assistance fi'om the State Government or any other body or Corporation owned and controlled by the State Government. \ , 48. The fee structure for all purposes shall be decided by the Executive Council provided that the University shall not charge any fee from its students in excess of what is required under any law of the State Government at the time being in force or as fixed by the Regulatory Bodies and the fees structure shall be put in public domain. 49. Within a period of five .years fi'om commencement of programmes, the University shall iobtain NAAC and other such accreditations as may be prescribed by the State Government from time to time. It shall also obtain certification/accreditation from such other Regulating Bodies which are connected with the courses taken up by the University. It shall inform the State Government about the grade provided to the University. The University shall ensure renewal of such accreditation from time to time. 50. The convocation of the University shall be held in every academic year in the manner as may be prescribed by the Statutes, the Ordinances and the Regulations for conferring degrees, diplomas or for any other purpose. 5]. (1) To ensure the compliance of the provisions of this Act, Statutes, Ordinances and Regulations made thereunder, the Uttar Pradesh State Higher Education Councilrs‘hall be the nodal agency. 5* , 191 _RPH_Data 4 Vidhaika Folder (Adhiniyam_2019) 45 General Fund Development Fund Maintenance of Funds The University shall be self financed Fees Accreditation of . the University Convocation The Uttar Pradesh Higher Education Council shall be the nodal agency for Private Universities

46 WaT 31W11%197 4 I'4d, 6 3171-€1, 2019

Power of State

Government to call

for information and

records

Dissolution of

University

Expenditure of the

University during

dissolution

Winding up of the

University by the

State Government

The records of the students admitted to the different courses of the University and their results and the records of the students not appearing in the examinations shall be provided to the Uttar Pradesh Higher Education Council. The final degree shall be conferred to the students with approval of the Uttar Pradesh Higher Education Council. The names of the persons to be awarded the degrees shall be submitted to The Uttar Pradesh Higher Education Council before 30 days of the date of convocation and the Council shall approve the list. In case approval of the Council is not communicated to the University within 20 days, the list shall be deemed to be approved.

The Uttar Pradesh Higher Education Council may call from the University or any authority or officer of the University to furnish any information or records of the University within specified date and time failing which the Uttar Pradesh Higher Education Council may send the report to the State Government for appropriate action.

The Uttar Pradesh Higher Education Council shall conduct atleast one annual inspection of the Universities established under this Act for the purpose of compliance of the provisions of this Act and to ensure imparting of quality education and submit its annual inspection report to the State Government specifically regarding the compliance of the undertaking given under section 3 of this Act.

(1) It shall be the duty of the University or any authority or officer of the University to furnish such information or records relating to the administration or finances and other affairs or activities etc. of the University as the State Government may call for.

(2) The State Government, if it is of the view that there is a violation of the Act, the Statutes, the Ordinances or the Regulations made thereunder may issue such directions to the University under this Act as it may deem necessary, and the University shall comply with such directions within the stipulated time.

(I) If the University proposes its dissolution in accordance with the law governing its constitution or incorporation, it shall give at least one year's written notice to the State Government.

(2) On receipt of notice referred to in sub-section (1), the State Government shall make such arrangements for administration of the University from the date of dissolution of the University and until the last batch of students in regular courses of, studies of the University complete their courses or studies in such manner as may be prescribed.

(1) The expenditure for administration of the University during the taking over of the liabilities of the University under section 53 of the Act shall be met out of the Permanent Endowment Fund, the general fund and the development fund.

(2) During this process, if the funds referred to in sub-section (1) are not sufficient to meet the expenditure and the liabilities of the University, such expenditure may be met by disposing off the properties and assets of the University by the State Government.

(1) If it appears to the State Government that the University has contravened any of the provisions of this Act, Statutes, Ordinances or Regulations made thereunder or has violated any of the directions issued by it under this Act or has ceased to carry out any of the undertakings given under section 3 or there is fraud or misappropriation or serious misuse of funds, it may issue direction to the Uttar Pradesh Higher Education Council to conduct preliminary inquiry.

(2) If the State Government, on receipt of inquiry report of the University on the direction issued under sub-section (1), is satisfied that there is a prima facie case of contravention of all or any of the provisions of this Act or the Statutes or Ordinances or Regulations made thereunder or of violation of directions issued by it under this Act or of ceasing to carry out the undertaking given under section 3, or there is fraud or misappropriation or serious misuse of funds, it shall make an order of such enquiry as it may consider necessary.

19I_RPHJDzaa 4 Vidhaika Folder (Adhiniyam_2019)

image45.tif

Power of State Government to call for information and records Dissolution of . University Expenditure of the ' University during dissolution Winding up ofthe University by the State Government Tic—(1? “a? W 1 GE, 6 GP F1, 2019 (2) The records of the students admitted to the different courses of the University and their results and the records of the students not appearing in the examinations shall be provided to the Uttar Pradesh Higher Education Council. The final degree shall be conferred to the students with approval of the Uttar Pradesh Higher Education Council. The names of the persons to be awarded the degrees shall be submitted to The Uttar Pradesh Higher Education Council before 30 days of the date of convocation and the Council shall approve the list. In case approval of the Council is not communicated to the University within 20 days, the list shall be deemed to be approved. (3) The Uttar Pradesh Higher Educatimi Council may call from the University or any authority or ofi‘icer of the University to furnish any information or records of the University within specified date and time failing which the Uttar Pradesh Higher Education Council may send the report to the State Government for appropriate action. (4) The Uttar Pradesh Higher Education Council shall conduct atleast one annual inspection of the Universities established under this Act for the purpose of compliance of the provisions of this Act and to ensure imparting of quality education and submit its annual inspection report to the State Government specifically regarding the compliance of the undertaking given under section 3 of th15 Act. 52. (1) It shall be the duty of the University or any authority or officer of the University to fumish such information or records relating to the administration or finances and other affairs or activities etc. of the University as the State Government may call for. (2) The State Government, if 1t is of the View that there 15 a violation of the Act, the Statutes, the Ordinances or the Regulations made thereunder may issue such directions to the University under this Act as it may deem necessary, and the University shall comply with such directions within the stipulated time. 53. (1) If the University proposes its dissolution in accordance ‘with the law governing its constitution or incorporation, it shall give at least one year’s written notice to the State Government. (2) On receipt of notice referred to in sub-section (1), the State Government shall make such arrangements for administration of the University from the date of dissolution of the University and until the last batch of students in regular courses of studies of the University complete their courses or studies 1n such manner as may be prescribed. - 54. (1) The expenditure for administration of the University during the taking oi/er of the liabilities of the University under section 53 of the Act shall be met out of the Permanent Endowment Fund, the general fund and the development fund. (2) During this process, if the funds referred to in sub-section (1) are not sufficient to meet the expenditure and the liabilities of the University, such expenditure may be met by disposing off the properties and assets of the University by the State Government. . 55. (1) If it appears to the State Government that the University has contravened any of the provisions of this Act, Statutes, Ordinances or Regulations made thereunder or has violated any of the directions issued by it under this Act or has ceased to carry out any of the undertakings given under section 3 or there is fraud or misappropriation or serious misuse of funds, it may issue direction to the Uttar Pradesh Higher Education Council to conduct preliminary inquiry. (2) If the State Government, on receipt of inquiry report of the University on the direction issued under sub-section (1), is satisfied that there is a prima facie case of contravention of all or any of the provisions of this Act or the Statutes or Ordinances or Regulations made thereunder or of violation of directions issued by it under this Act or of ceasing to carry out the undertaking given under section 3, or there is fraud or misappropriation or serious misuse of funds, it shall make an order of such enquiry as it may consider necessary. l9l_RPH_Data 4 Vidhaika Folder (Adhiniynijlg)

\icth Ift31 3TUTETRUT , 6 3179?1, 2019

(3) For the purposes of an inquiry under sub-section (2), the State Government

shall, by notification, appoint an officer or a committee on the recommendation of the

Uttar Pradesh Higher Education Council as the inquiring authority to inquire into the

allegations of violation of the provisions of this Act.

(4) Every inquiring authority appointed under sub-section (3) shall while

performing its functions under this Act have all the powers of Civil Court under the

Code of Civil Procedure, 1908 while trying a suit and in particular in respect of the

following matters, namely:-

summoning and enforcing the attendance of any witness and examining

him on oath;

requiring the discovery and production of any document;

requisitioning any public record or copy thereof from any office;

receiving evidence on affidavit; and

any other matter which may be prescribed.

(5) If, upon receipt of the inquiry report, the State Government is satisfied that

the University has violated any provisions of this Act and there is a need for corrective

action, the State Government shall direct the University to make necessary

improvements within the specified time, in order to comply with the provisions of this

Act. If the University fails to comply with such directions within specified time, the

State Government may again direct the University to make necessary improvements or

modifications within a period of 15 days from the issuance of such directions.

(6) On receipt of the enquiry report from the enquiry officer or the enquiry

committee appointed under sub-section (3), if the State Govemment is satisfied that the

University has contravened all or any of the provisions of this Act or the Statutes or

Ordinances or Regulations made thereunder or has violated any of the directions issued

by it under this Act including directions issued under sub-section(5) above or has ceased

to carry out the undertakings given by it under section 3 or there is fraud or

misappropriation or serious misuse of funds in the University which threatens the

academic standard of the University, the State Government for liquidation of the

University, shall appoint a interim committee consisting of three members to run the

affairs of the University during the period.

(7) (i) The interim committee appointed under sub-section (6) shall have all the

powers to administer the affairs of the University until the last batch of the students of

the regular courses have completed their courses and they have been awarded degrees,

diplomas or awards as the case may be;

After having been awarded the degrees, diplomas or awards, as the case may

be, to the last batches of the students of the regular courses, the interim committee shall

make a report to the effect to the State Government;

On receipt of the report under sub-section (7) (ii), the State Government

shall, by a notification in the Official Gazette, issue an order dissolving the University

and from the date of publication of such notification, the University shall stand dissolved

and all the remaining assets and liabilities of the University shall vest in the sponsoring

body from such date.

(8) Every notification under sub-section (7), shall be laid before both Houses of

the State Legislature.

56. The State Government may issue such directions from time to time to the

University on policy matters not inconsistent with the provisions of this Act as it may

deem necessary. Such directions shall be complied with by the University, failing which

the State Government may take a reasoned action against the University in accordance

with this Act.

Power of the

State Government

to issue directions

on policy matters

191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image46.tif

WWWW,6W, 2019 (3) For the purposes of an inquiry under sub-section (2), the State Government shall, by notification, appoint an officer or a committee on the recommendation of the Uttar 'Pradesh Higher Education Council as the inquiring authority to inquire into the allegations ofviolation ofthe provisions ofthis Act. ‘ (4) Every inquiring authority appointed under sub~section (3) shall while performing its functions under this Act have all the powers of Civil Court under the Code of Civil Procedure, 1908 while trying a suit and in particular in respect of the following matters, namely:- ' (a) summoning and enforcing the attendance of any witness and examining him on oath; (b) requiring the discovery and production of any document; (c) requisitioning any public record or copy thereof from any office; (d) receiving evidence on affidavit; and (e) any other matter which may be prescribed. (5) If, upon receipt of the inquiry report, the State Government is satisfied that the University has violated any provisions of this Act and there is a need for corrective action, _ the State Government shall direct the University to make necessary improvements within the specified time, in order to comply with the provisions of this Act. If the University fails to comply with such' directions within specified time, the State Government may again direct the University to make necessary improvements or modifications within a period of 15 days from the issuance of such directions. (6)_On receipt of the enquiry report fi'om the enquiry officer or the enquiry committee appointed under sub-section (3), if the State Government is satisfied that the University has contravened all or any'of the provisions of this Act or the Statutes or Ordinances or Regulations made thereunder or has violated any of the directions issued by it under this Act including directions issued under sub-section(5) above or has ceased to carry out the undertakings given by it under section 3 or there is fraud or misappropriation or serious misuse of funds in the University which threatens the academic standard of the University, the State Government for liquidation of the University, shall appoint a interim committee consisting of three members to run the affairs of the University during the period. I (7) (i) The interim committee appointed under sub-section (6) shall have all the powers to administer the affairs of the University until the last batch of the students of the regular courses have completed their courses and they have been awarded degrees, diplomas or awards as the case may be; (ii) Afier having been awarded the degrees, diplomas or awards, as the case may be, to the last batches of the students of the regular courses, the interim committee shall make a report to the effect to the State Government; (iii) On receipt of the report under sub-section (7) (ii), the State Government shall, by a notification in the Official Gazette, issue an order dissolving the University and from the date of publication of such notification, the University shall stand dissolved and all the remaining assets and liabilities of the University shall vest in the sponsoring body fiom such date. _ (8) Every notification under sub—section (7), shall be laid before both Houses of the State Legislature. 56. The State Government may issue such directions from time to time to the University on policy matters not inconsistent with the provisions of this Act as it may deem necessary. Such directions shall be complied with by the University, failing which the State Government may take a reasoned action against the University in accordance with this Act. l9l_R.PH>Data 4 Vidhaika Folder (Adhiniyam_2019) 1 47 Power of the State Government to issue directions on policy matters

48 14 Yr 3711T-TRuT Iv1d, 6 3171R?f, 2010

Power to remove

difficulties

Repeal and savings

Minority Private

Universities

57. All residual assets and properties including permanent endowment fund,

general fund or any other fund and the liabilities of the University shall belong to the

Sponsoring Body in case of dissolution of the University under any provision

mentioned herein above in the Act.

58. (1) The State Government may, by notification in the Gazette, make rules

for carrying out the purposes of this Act.

(2) Without prejudice to the generality of the foregoing provisions, such rules

may provide for all or any of the following matters, namely:-

the manner of making proposal to establish a University and the

application fees payable under sub-section (1) of section 4;

other particulars to be contained in the Project Report under

sub-section (2) of section 4;

other matters which are required to be, or may be, prescribed by rules

under this Act.

59. (1) The State Government may for the purposes of removing any

difficulties, particularly in relation to the transition from the provisions of the

individual Private University Acts to the provisions of this Act, direct that the

provisions of this Act shall during such period as may be specified in the order, have

effect subject to such adaptations, whether by way of modification, addition or

omission, as it may deem necessary or expedient:

Provided that no such order shall be made after two years from the date of

commencement of this Act.

(2) Every order made under sub-section (1) shall be laid before both Houses of

State Legislature as soon as may be after it is made.

60. All disputes arising as a result of the provisions made in this Act shall be

settled by a Court of law in the State of Uttar Pradesh.

61. The provisions of this Act and the Statutes, Ordinances and Regulations

made there under shall have effect notwithstanding anything to the contrary contained

in any other law, for the time being in force, made by the State Legislature relating to

Universities.

62. (1) All the Acts enumerated in the Schedule-1 to this Act shall stand

repealed on the commencement of this Act.

Notwithstanding the repeal of the Acts enumerated in the Schedule-1

mentioned in sub-section (1), all the decisions made, Acts performed, rights and

liabilities created and exhausted by the Universities established under the repealed

Acts shall be deemed to be valid under this Act.

The Universities incorporated into this Act shall modify their Statutes,

Ordinances and Regulations applicable thereto under their respective repealed Acts, to

bring them in conformity with the provisions of this Act within a period of one year

from the date of commencement of this Act.

63. Notwithstanding anything contained in this Act the University established

by a religious or linguistic minority of the State of Uttar Pradesh, shall continue to

have the privileges as guaranteed by Article 30 of the Constitution of India.

Status of Assets / Liabilities on dissolution / de-re,cognition

Power to make rules

Disputes to be settled

in a Court in Uttar

Pradesh

The Ordinance to

have overriding effect

19I_RPH Data 4 Vidhaika Fr er (Adhiniyam_2019)

image47.tif

48 WWWW,GW,ZO19 V _—____—_’____—_—————I— Slams “Asset-W 57. All residual assets and properties including permanent endowment fund, 5:33:33" general fund or any other fund and the liabilities of the University shall belong to the de-recognition Sponsoring Body 'in case of dissolution of the University under any provision mentioned herein above in the Act. ‘ Power 10 make rules 58. (l) The State Government may, by notification in the Gazette, make rules ' for carrying out the purposes of this Act. , (2) Without prejudice to the generality of the foregoing provisions, such rules may provide for all or any of the following matters, namely:- ‘ (a) the manner of making proposal to establish a University and the application fees payable under sub-section (1) of section 4; (b) other particulars to be contained in the Project Report under sub-section (2) of section 4; (c) other matters which are required to be, or may be, prescribed by rules under this Act. Powerlomnove 59. (l) The State Government may for the purposes of removing any d'mcuh'es difficulties, particularly in relation to the transition from the provisions of the individual Private University Acts to the provisions of this Act, direct that the provisions of this Act shall during such period as may be specified in the order, have effect subject to such adaptations, whether by wayvof modification, addition or omission, as_it may deem necessary or expedient: Provided that no such order shall be made alter two years from the date of commencement of this Act. (2) Every order made under sub-section (1) shall be laid before both Houses of State Legislature as soon as may be afier it is made. PisputeSfltbc settled 60. All disputes arising'vas a result of the provisions made in this Act shall be '" “com '" um" settled by a Court of law in the State of Uttar Pradesh. Pradesh - The Ordinflnw '0 61.‘ The provisions of this Act and the Statutes, Ordinances and Regulations have “midi“ me" made there under shall have effect notwithstanding anything to the contrary contained in any other law, for the time being in force, made by the State Legislature relating to Universities. ' ‘ Repeal and Savings 62. (l) All the Acts enumerated in the Schedule-l to this Act shall stand - repealed on the commencement of this Act. (2) Notwithstanding the repeal of the Acts enumerated in the Schedule-1 mentioned in sub-section (1), all the decisions made, Acts performed, rights and liabilities created and exhausted by the Universities established under the repealed Acts shall be deemed to be valid under this Act. (3) The Universities incorporated into this Act shall modify their Statutes, Ordinances and Regulations applicable thereto under their respective repealed Acts, to bring them in conformity with the provisions of this Act within a period of one year fi‘om the date of commencement of this Act. Milfon'ty Private ' 63. Notwithstanding anything contained in this Act the University established ”mam“ by a religious or linguistic minority of the State of Uttar Pradesh, shall continue to have the privileges as guaranteed by Article 30 of the Constitution of India. l9l_RPHVDnta 4 Vidhaika Fr er (AdhiniyamAZOI9)

\iati SItT 3WIT1Rui 1lJ1C 6 3T1Ti?1, 2019

SCHEDULE-1

(See Section-8)

SI. Details of the Act Name of the University

1 The Integral University Act, 2004

(U.P. ACT NO. 9 OF 2004) Notification Dated 27-02-2004 .

The Integral University, Luckrtow

2 The Amity University Uttar Pradesh Act, 2005

(U.P. ACT NO. 11 OF 2005) Notification Dated 24-03-2005

Amity University Gautambudh Nagar, Uttar Pradesh

3 The Mangalayatan University Uttar Pradesh Act, 2006

(U.P. ACT NO. 32 OF 2006) Notification Dated 30-10-2006

Mangalayatan University Aligarh, Uttar Pradesh

4 The Swami Vivekanand Subharti University Uttar Pradesh Act, 2008

(U.P. ACT NO. 29 OF 2008) Notification Dated 05-09-2008

Swami Vivekanand Subharti University, Merrut, Uttar Pradesh

5 The Teerthanker Mahaveer University Uttar Pradesh Act, 2008 (UP. ACT NO. 30 OF 2008) Notification Dated 05-09-2008

Teerthanker Mahaveer University, Moradabad, Uttar Pradesh

6 The Sharda University Uttar Pradesh Act, 2009

(U.P. ACT NO. 14 OF 2009) Notification Dated 24-03-2009

Sharda University Greater Noida, Uttar Pradesh

7 The GLA University Uttar Pradesh Act, 2009

(U.P. ACT NO. 21 OF 2010) Notification Dated 01-09-2010

GLA University Mathura, Uttar Pradesh

8 The Invertis University Uttar Pradesh Act, 2009

(U.P. ACT NO. 22 OF 2010) Notification Dated 01-09-2010

invertis University Bareilly, Uttar Pradesh

9 The Monad University Uttar Pradesh Act, 2010

(U.P. ACT NO. 23 OF 2010) Notification Dated 12-10-2010

Monad University Gaziabad,

Uttar Pradesh

10 The Noida International University Uttar Pradesh Act, 2010 (U.P. ACT NO. 27 OF 2010) Notification Dated 12-10-2010

Noida International University Gautam Buddha Nagar, Uttar Pradesh

11 The IFTM University Uttar Pradesh Act, 2010

(U.P. ACT NO. 24 OF 2010) Notification Dated 12-10-2010

IFTM University, Omkar Dham Lodhipur Rajput, Delhi Road Moradabad

12 Shri Venkateshwara University Uttar Pradesh Act, 2010 SOP. ACT NO. 26 OF 2010) Notification Dated ,1:.12:10-2010

Shri Venlcateshwara, Gajraula, J.P. Nagar

/ The Babu Banarasi Das Universitytttar Pradesh Act, 2010 (U.P. ACT NO. 25 OF 2010) Notification Dated 12-10-2010

Babu Banarasi Das University, Lucknow

'

I 9I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image48.tif

SCHEDULE-1 (See-Section-B) W new WWW—cits 31m, 2019 49 Si. Details of the Act Name of the University 1 . The Integral University Act, 2004 The Integral University, Lucknow (U.P. ACT NO. 9 OF 2004) Notification Dated i 27-02-2004 l—Z The Amity University Uttar Pradesh Act, 2005 Amity University Gautambudh Nagar, (up. ACT No. 11 or 2005) Notification Dated Uttar Pradesh J 24-03-2005 ——i 3 The Mangalayatan University Uttar Pradesh Act, 2006 i-]:Iianga]ayatan University Aligarh, Uttar ' (11?. ACT No. 32 OF 2006) Notification Dated Pradesh ‘ 30-10-2006 . . 4 The Swami Vivekanand Subharti University Uttar l—Swami Vivekanand Subharti Pradesh Act, 2008 University, Merrut, Uttar Pradesh ( (U.P. ACT NO. 29 OF 2008) Notification Dated 05-09-2008 ' 5 The Teerthanker Mahaveer University Uttar Pradesh Teenhanker Mahaveer University, ’ Act, 2008 Moradabad, Uttar Pradesh (UP. ACT NO. 30 OF 2008) Notification Dated 05-09-2008 6 The Sharda University UttarPradesh Act, 2009 Sharda University Greater Noida, Uttar (up. ACT N0, 14 OF 2009) Notification Dated Pradesh 24-03-2009 7 The GLA University Uttar Pradesh Act, 2009 GLA University Mathura, Uttar (in. ACT NO. 21- or 2010) Notification Dated Pradesh 01-09-2010 8 The Invertis University Uttar Pradesh Act, 2009 invertis University Bareiily, Uttar (11.1). ACT No. 22 or 2010) Notification Dated Pradesh 01-09-2010 9 The Monad University Uttar Pradesh Act, 2010 Monad University Gaziabad, (U.P. ACT NO. 23 or 2010) Notification Dated Uttar Pradesh ' 12-10-2010 ‘ 10 The Noida lntemational University Uttar Pradesh Act, Noida International University Gautam 2010 ' Buddha Nagar, Uttar Pradesh (U.P. ACT NO. 27 OF 2010) Notification Dated ‘ 12-10—2010 1 1 The IFTM University Uttar Pradesh Act, 2010 iFTM University, Ontkar Dham (up. ACT N0. 24 OF 2010) Notification Dated Lodhipur RaJPut: Delhi Road , 12_10_2010 Moradabad 12 Shri Venkateshwara University Uttar Pradesh Act, Shri Venkateshwara, Gajraula, J P. 2010 Nagar - £11.? ACT NO. 26 OF 2010) Notification Dated ‘ _; f12-10-2010 L. T ‘ ' . . 13" ' The Babu Banarasi Das University'Uttar Pradesh Act, Babu Banarasi Das Un1ver31ty, I 2010 . Lucknow . (U.P. ACT NO. 25 OF 2010) Notification Dated 12-10-2010 L ‘ l9l7RPH_Data 4 Vidhaika Folder (Adhiniyam72019) , r

50

\6ck-k- SlicqT 31RW-TRIIT quit, 6 31-11iT1, 2019

14 The Galgotias University Uttar Pradesh Act, 2011

(U.P. ACT NO. 14 OF 2011) Notification Dated 07-04-2011

The Galgotias University, Gautambudh Nagar

15 The Shivnadar University Uttar Pradesh Act, 2011

(U.P. ACT NO. 12 OF 2011) Notification Dated 21-06-2011

The Shivnadar University Dadri Gautambudh Nagar

16 The Ram Swaroop Memorial University Uttar Pradesh Act, 2011

(U.P. ACT NO. 1 OF 2012) Notification Dated 04-07-2012

Shri Ram Swaroop Memorial University, Barabanki

17 The Mohammad Ali Jauhar University Uttar Pradesh Act, 2005

(U.P. ACT NO. 19 OF 2006)

Notification Dated 19-06-2006

The Mohammad Ali Jauhar University, Rampur

18 The Glocal University Uttar Pradesh Act, 2011

(U.P. ACT NO. 2 OF 2012) Notification Dated 05-07-2012

The Glocal University Ali Akbarpur, Saharanpur

19 The Rama University Uttar Pradesh Act, 2013

(U.P. ACT NO. 1 OF 2014) Notification Dated 10-01-2014

Rama University, Kanpur

20 The Shobit University Uttar Pradesh Act, 2011

(U.P. ACT NO. 3 OF 2012) Notification Dated 05-07-2012

Shobit University, Gangoh, Saharanpur

21 The J.P. University Uttar Pradesh Act, 2014

(U.P. ACT NO. 8 OF 2014) Notification Dated 04-3-2014

J.P. University Anoop Shahar, Uttar Pradesh

22 The J.S. University Shikohabad, Firozabad, Uttar Pradesh Act, 2015

(U.P. ACT NO. 7 OF 2015) Notification Dated 24-6-2015

J.S. University Shikohabad, Firozabad

23 The IIMT University, Meerut, Uttar Pradesh Act, 2016

(UP. ACT NO. 32 OF 2016) Notification Dated 03-10-2016

IIMT University, Meerut, Uttar Pradesh

24 The Bennett University, Greater Noida, Uttar Pradesh, Act, 2016

(U.P. ACT NO. 24 OF 2016) Notification Dated 16-9-2016

Bennett University, Greater Noida, Gautam Buddha Nagar

25 The Bareilly International University, Uttar Pradesh Act, 2016

(U.P. ACT NO. 26 OF 2016) Notification Dated 16-9-2016

Bareilly International University, Bareilly

26 The Sanskriti University, Chhata, Mathura, Uttar Pradesh Act, 2016

(U.P. ACT NO. 20 OF 2016) Notification Dated 16-9-2016

Sanskriti University, Chhata, Mathura

.

27 The Era University, Lucknow, Uttar Pradesh Act, 2016

(U.P. ACT NO. 27 OF 2016) Notification Dated 16-9-2016

Era University, Lucknow, Uttar Pradesh

191 RPH

image49.tif

50 WYHE‘SIWWE, 6 317m, 2019 14 The Galgotias University Uttar Pradesh Act, 201 l The Galgotias University, Gautambudh (11?. ACT No. 14 or 201 1) Notification Dated Nag” I, 07-04-201 1 15 The Shivnadar University Uttar Pradesh Act, 2011 The Shivnadar University Dadri (up. ACT No. 12 OF 201 1) Notification Dated Gautambudh Nag?" 21-06-201 1 16 The Ram Swaroop Memorial University Uttar Pradesh Shri Ram Swaroop Memorial Act, 201 1 . University, Barabanki (UP. ACT NO. 1 OF 2012) Notification Dated 04-07—2012 17 The Mohammad Ali Jauhar University Uttar Pradesh 1 The Mohammad Ali Jauhar University, Act, 2005 Rampur (UP. ACT NO. 19 OF 2006) Notification Dated 19-06-2006 18 The Glocal University Uttar Pradesh Act, 2011 The Glocal University Ali (11.1). ACT No.2 OF 2012) Notification Dated Akbarpurr Saharanpur 05-07-2012 .- 19 The Rama University Uttar Pradesh Act, 2013 Rama University, Kanpur (UP. ACT NO. 1 OF 2014) Notification Dated 10-01-2014 20 The Shobit University Uttar Pradesh Act, 2011 Shobit University, Gangoh, (UP. ACT NO. 3 OF 2012) Notification Dated Saharanpur 05-07-2012 21 The 11’. University Uttar Pradesh Act, 2014 ].P. University Anoop Shahar, Uttar (UP. ACT N0. 8 OF 2014) Notification Dated Pradesh 04-3-2014 22 The IS. University Shikohabad, Firozabad, Uttar 1.5. University Shikohabad, Pradesh Act, 2015 Firozabad (UP. ACT NO. 7 OF 2015) Notification Dated 24-6-2015 23 The IIMT University, Meerut, Uttar Pradesh Act, IIMT University, Meerut, Uttar ‘ 2016 Pradesh (UP. ACT NO. 32 OF 2016) Notification Dated 03-10-2016 24 The Bennett University, Greater Noida, Uttar Bennett University, Greater Noida, Pradesh, Act, 2016 Gautam Buddha Nagar (UP. ACT N0. 24 OF 2016) Notification Dated 16-9-2016 25 The Bareilly International University, Uttar Bareilly International University, Pradesh Act, 2016 Bareilly (UP. ACT NO. 26 OF 2016) Notification Dated 16-9-2016 26 The Sanskriti University, Chhata, Mathura, Uttar Sanskriti University, Chhata, Pradesh Act, 2016 Mathura (up. ACT NO. 20 OF 2016) Notification Dated ‘ 16-9-2016 ' 27 The Era University, Lucknow, Uttar Pradesh Act, ' Era University, Lucknow, Uttar 2016 Pradesh (UP. ACT NO. 27 OF 2016) Notification Dated 16—9-2016 191 RPH

‘icth At2T 313iTzTRuT diu1d, 6 3171-R?f, 2019

SCHEDULE-2

(See Section-7)

SI. Details of the Act Name of the University

1 The Integral University Act, 2004

(U.P. ACT NO. 9 OF 2004) Notification Dated 27-02-2004

The Integral University, Lucknow

2 The Amity University Uttar Pradesh Act, 2005

(U.P. ACT NO. 11 OF 2005) Notification Dated 24-03-2005

Amity University Uttar Gautambudh Nagar, Pradesh

3 The Mangalayatan University Uttar Pradesh Act, 2006

(U.P. ACT NO. 32 OF 2006) Notification Dated 30-10-2006

Mangalayatan University Aligarh, Uttar Pradesh

4 The Swami Vivekanand Subharti University Uttar Pradesh Act, 2008

(U.P. ACT NO. 29 OF 2008) Notification Dated 05-09-2008

Swami Vivekanand Subharti University, Men-ut, Uttar Pradesh

5 The Teerthanker Mahaveer University Uttar Pradesh Act, 2008

(U.P. ACT NO. 30 OF 2008) Notification Dated 05-09-2008

Teerthanker Mahaveer University, Moradabad, Uttar Pradesh

6 The Sharda University Uttar Pradesh Act, 2009

(U.P. ACT NO. 14 OF 2009) Notification Dated 24-03-2009

Sharda University Greater Noida, Uttar Pradesh

7 The GLA University Uttar Pradesh Act, 2009

(U.P. ACT NO. 21 OF 2010) Notification Dated 01-09-2010

GLA University Mathura, Uttar Pradesh

8 The Invertis University Uttar Pradesh Act, 2009

(U.P. ACT NO. 22 OF 2010) Notification Dated 01-09-2010

Invertis University Bareilly, Uttar Pradesh

9 The Monad University Uttar Pradesh Act, 2010

(U.P. ACT NO. 23 OF 2010) Notification Dated 12-10-2010

Monad University Gaziabad,

Uttar Pradesh

10 The Noida International University Uttar Pradesh Act, 2010 . (U.P. ACT NO. 27 OF 2010) Notification Dated 12-10-2010

Noida International University Gautam Buddha Nagar, Uttar Pradesh

11 The IFTM University Uttar Pradesh Act, 2010

(U.P. ACT NO. 24 OF 2010) Notification Dated 12-10-2010

IFTM University, Omkar Dham Lodhipur Rajput, Delhi Road Moradabad

12 Shri Venkateshwara University Uttar Pradesh Act, 2010 (U.P. ACT NO. .26 OF 2010) Notification Dated 12-10-2010

Shri Venkateshwara, Gajraula, J.P. Nagar

13 The Babu Banarasi Das University Uttar Pradesh Act, 2010 ..-

(U.P. ACT NO. 25 OF 2010) Notification Dated 12-10-2010

Babu Banarasi Das University, Lucknow

14 The Galgotias University Uttar Pradesh Act, 2011

(U.P. ACT NO. 14 OF 2011) Notification Dated 07-04-2011

The Galgotias University, Gautambudh Nagar

:19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

image50.tif

WWWW,SW, 2019 51 SCHEDULE-2 (See Section-7) 81. Details ofthe Act Name ofthe University l The Integral University Act, 2004 > The lntegralUniversity, Lucknow (U.P. ACT N01 9 OF 2004) Notification Dated ' 27-02-2004 2 The Amity University Uttar Pradesh Act, 2005 Amity University Uttar Gautambudh (U.P. ACT NO. 11 OF 2005) Notification Dated Nagaril’radesh 24-03-2005 ' 3 The Mangalayatan University Uttar Pradesh Act, 2006 Mangalayatan University Aligarh, Uttar (U.P. ACT NO. 32 OF 2006) Notification Dated Pradesh 30-10-2006 4 The Swami Vivekanand Subharti University Uttar' Swami Vivekanand Subharti Pradesh Act, 2008 University, Merrut, Uttar Pradesh L (U.P. ACT NO. 29 OF 2008) Notification Dated 05-09-2008 . 5 The Teerthanker Mahaveer University Uttar Pradesh Teerthanker Mahaveer University, ‘, Act, 2008 Moradabad, Uttar Pradesh - 1 (U.P. ACT NO. 30 OF 2008) Notification Dated 05-09-2008 ~ 6 The Sharda University Uttar Pradesh Act, 2009 Sharda University Greater Noida, Uttar (U.P. ACT No. 14 OF 2009) Notification Dated Pradesh 24-03-2009 . ‘ 7 The GLA University Uttar Pradesh Act, 2009 GLA University Mathura, Uttar (U.P. ACT NO. 21 OF 2010) Notification Dated Pradesh 01-09-2010 8 The Invertis University Uttar Pradesh Act, 2009 Invertis University Bareilly, Uttar (UMP ACT No. 22 OF 2010) Notification Dated Pradesh ' 01- 09- 2010 9 The Monad University Uttar Pradesh Act, 2010 ' Monad University Gaziabad, (U.P. ACT NO. 23 OF 2010) Notification Dated Uttar Pradesh 1240-2010 10 The Noida lntemational University Uttar Pradesh Act, 'Noida lntemational University Gautam A 2010 Buddha Nagar, Uttar Pradesh ' . (UP. ACT NO. 27 OF 2010) Notification Dated v L 12 10- 2010 . _ ‘ ‘ ll TheIFTM University Uttar Pradesh Act 2010 IFTM University, Omkar Dham (U..P ACT No 24 OF 2010) Notification Dated Lodhipur Rajput, Delhi Road 12.10.2010 Moradabad _ 12 Shri Venkateshwara University Uttar Pradesh Act, ShriVenkateshwara,Gajraula,J.P. 2010 . Nagar (U.P. ACT NO. .26 OF 2010) Notification Dated 12-10-2010 . 13 The Babu Banarasi Das University Uttar Pradesh Act, Babu Banarasi Das University, 2010 v Lucknow (U.P ACT NO. 25 OF 2010) Notification Dated 12-10-2010 14 The Galgotias University Uttar Pradesh Act, 2011 The Galgotias University, Gautambudh (U.P. ACT NO. 14 OF 2011) Notification Dated Nagar 07-04-20” .1917RPH_Data 4 Vidhaika Folder (Adhiniyam72019)

52

th-t-(1 11c1 31711tIgui 6 31-71, 2019

15 The Shivnadar University Uttar Pradesh Act, 2011 (U.P. ACT NO. 12 OF 2011) Notification Dated 21-06-2011

The Shivnadar University Dadri Gautambudh Nagar

16 The Ram Swaroop Memorial University Uttar Pradesh Act, 2011 (U.P. ACT NO. 1 OF 2012) Notification Dated 04-07-2012

Shri Ram Swaroop Memorial University, Barabanki

17 The Mohammad All Jauhar University Uttar Pradesh Act, 2005 (U.P. ACT NO. 19 OF 2006)

Notification Dated 19-06-2006

The Mohammad All Jauhar University, Rampur

18 The Glocal University Uttar Pradesh Act; 2011

(U.P. ACT NO. 2 OF 2012) Notification Dated 05-07-2012

The Glocal University Ali Akbarpur, Saharanpur

19 The Rama University Uttar Pradesh Act, 2013

(U.P. ACT NO. 1 OF 2014) Notification Dated 10-01-2014

Rama University, Kanpur

20 The Shobit University Uttar Pradesh Act, 2011

(U.P. ACT NO. 3 OF 2012) Notification Dated 05-07-2012

Shobit University, Gangoh, Saharanpur •

21 The J.P. University Uttar Pradesh Act, 2014

(U.P. ACT NO. 8 OF 2014) Notification Dated 04-3-2014

J.P. University Anoop Shahar, Uttar Pradesh

22 The J.S. University Shikohabad, Firozabad, Uttar Pradesh Act, 2015

(U.P. ACT NO. 7 OF 2015) Notification Dated 24-6-2015

J.S. University Shikohabad, Firozabad

23 The IIMT University, Meerut, Uttar Pradesh Act, 2016

(U.P. ACT NO. 32 OF 2016) Notification Dated 03-10-2016

IIMT University, Meerut, Uttar Pradesh

24 The Bennett University, Greater Noida,

Uttar Pradesh Act, 2016

(U.P. ACT NO. 24 OF 2016) Notification Dated 16-9-2016

Bennett University, Greater Noida, Gautam Buddha Nagar

25 The Bareilly International University, Uttar Pradesh Act, 2016

(U.P. ACT NO. 26 OF 2016) Notification Dated 16-9-2016

Bareilly International University, Bareilly

26 The Sanskriti University, Chhata, Mathura, Uttar Pradesh Act, 2016

(U.P. ACT NO. 20 OF 2016) Notification Dated 16-9-2016

Sanskriti University, Chhata, Mathura

27 The Era Univesity, Lucknow, Uttar Pradesh Act, 2016

(U.P. ACT NO. 27 OF 2016) Notification Dated 16-9-2016

Era University, Lucknow, Uttar Pradesh

191 RPH

image51.tif

52 Wmsmmwwmwmnzms. 15 The Shivnadar University Uttar Pradesh Act, 20l1 The Shivnadar University Dadri (UP. ACT NO. 12 OF 2011) Notification Dated Gautambudh Nagar 21-06-2011 - 16 The Ram Swaroop Memorial University Uttar Pradesh Shri Ram Swaroop Memorial Act, 201 1 University, Barabanki (U.P. ACT NO. 1 OF 2012) Notification Dated 04-07-2012 17 The Mohamrnad Ali Jauhar University Uttar Pradesh The Mohammad Ali Jauhar Act, 2005 University, Rampur (U.P. ACT NO. 19 OF 2006) Notification Dated 19-06-2006 1 18 The Glocal University Uttar Pradesh Act, 2011 The Glocal University Ali (UP. ACT N0. 2 OF 2012) Notification Dated Akbarpur, Saharanpur 05-07-2012 19 The Rama University Uttar Pradesh Act, 2013 Rama University, Kanpur (UP. ACT NO. 1 OF 2014) Notification Dated 10-01-2014 20 The Shobit University Uttar Pradesh Act, 2011 Shobit University, Gangoh, (U.P. ACT NO. 3 OF 2012) Notification Dated Saharanpur 05-07-2012 21 The LP. University Uttar Pradesh Act, 2014 ].I’. University Anoop Shahar, Uttar (UP. ACT NO. 8 OF 2014) Notification Dated Pradesh 04-3-2014 22 The ].S. University Shikohabad, Firozabad, Uttar ].S. University Shikohabad, Pradesh Act, 2015 Firozabad (U.P. ACT NO. 7 OF 2015) Notification Dated 24-6-2015 ‘ 23 The IIMT University, Meerut, Utter Pradesh Act, IIMT University, Meerut, Uttar 2016 Pradesh (U.P. ACT NO. 32 OF 2016) Notification Dated 03-10-2016 24 The Bennett University, Greater Noida, Bennett University, Greater Noida, Uttar Pradesh Act, 2016 Gautam Buddha Nagar (UP. ACT NO. 24 OF 2016) Notification Dated 16-9-2016 25 The Bareilly‘ International University, Uttar Bareilly International University, Pradesh Act, 2016 Bareilly (U.P. ACT NO. 26 OF 2016) Notification Dated L16-9-2016 26 The Sanskriti University, Chhata, Mathura, Uttar I_S‘ansl<rit1' University, Chhata, Pradesh Act, 2016 Mathura (U.P. ACT NO. 20 OF 2016) Notification Dated 16-9-2016 27 The Era Univesity, Lucknow, Uttm Pradesh Act, Era University, Lucknow, Uttar 2016 Pradesh (U.Pi ACT NO. 27 OF 2016) Notification Dated 16-9-2016 1.

at( 4iv1d, 6 311TR?1, 2019

STATEMENT OF OBJECTS AND REASONS

In accordance with the guidelines under the Government Order dated February 06, 2008, twenty

seven private Universities have been established and incorporated by different State Acts. Since different

Acts of different Universities contains different provisions and there is no uniform provision for

monitoring of such Private Universities, it has become difficult to implement and enforce the policies of

the State Government, to collect information and records and to implement the standards of quality in

higher education. It has, therefote, been decided to make an umbrella Act to govern all the Private Universities

under a common law.

The Uttar Pradesh Private Universities Bill, 2019 is introduced accordingly.

By order,

J.P. SINGH-11, _

Pramukh Sachiv.

410RIT0ZL0410-701:110 191 1)111-1 —0t40-2019—(565)-599 Aratit—(WMEL07/t1/318:54e) I

4t0cRi0Z01071 04310 68 TITO fatTRI1-2019—(566) -300 Ard-81—(MTGEL07/ a/ 3178tre) I

19I_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)

image52.tif

Wmmwmwm, 2019 53 i g STATEMENT OF OBJECTS AND REASONS In accordance with the guidelines under the Government Order dated February 06, 2008, twenty seven private Universities have been establiShed and incorporated by different State Acts. Since different Acts of different Universities contains different provisions and there is no uniform provision for monitoring of such Private Universities, it has become difiicult to implement and enforce the policies of the State Government, to collect information and records and to implement the sténdards of quality in higher education. ‘ It has, therefore, been decided to make an umbrella Act to govern all the Private Universities under a common law. The Uttar Pradesh Private Universities Bill, 2019 is introduced accordingly. I» By order, J.P. SINGH-ll, Pramukh Sachr'v. m mowoqoifio—thho 191 W—(fiafikzom—(sesysos m—W/a/mn ii, ' mowoqotl’tojqofio 68 W0 fourth—201s—(566Hoo Wei—(3751213? / a / WM ‘1 y' V . , l9l_RPH‘Dat_a 4 Vidhaika Fold (Adhiniynm_2019)

t

image53.tif

  • 00000001
  • 00000002
  • 00000003
  • 00000004
  • 00000005
  • 00000006
  • 00000007
  • 00000008
  • 00000009
  • 00000010
  • 00000011
  • 00000012
  • 00000013
  • 00000014
  • 00000015
  • 00000016
  • 00000017
  • 00000018
  • 00000019
  • 00000020
  • 00000021
  • 00000022
  • 00000023
  • 00000024
  • 00000025
  • 00000026
  • 00000027
  • 00000028
  • 00000029
  • 00000030
  • 00000031
  • 00000032
  • 00000033
  • 00000034
  • 00000035
  • 00000036
  • 00000037
  • 00000038
  • 00000039
  • 00000040
  • 00000041
  • 00000042
  • 00000043
  • 00000044
  • 00000045
  • 00000046
  • 00000047
  • 00000048
  • 00000049
  • 00000050
  • 00000051
  • 00000052
  • 00000053
  • 00000054
SECTIONS