<-ICQII-151 (-2) '<1imi -Pi —kreoTeatito /Rao
5.sciptcro410-91/2014-16
are:19i
tifetta 177 Uff? ribT
zwz 04114 taw( ITU TM-TOM
3111TEIRT
Ell 4 ibC
Tfri-1, (.4'14 (W)
(.11-ft rrksT arfirftaff)
41 6 Mtd, 2019 _
41Mut 15, 1941 img
\TO( wavr
ft-Trzft arlffm-1
11tsgi 1451/79-R-1-19-1M11-19
emith, 6 311T1, 2019
aiRRFT
real%
"Tuff T•tifdEn-r" aira 200 alt tivtimictf 96t(41 31T Sib' fdl RYcirdqiciti
Ng% 2019 f3fti 3T %tn. aT1FT-1 ImitAct) t tiksAid L ct Riich
5 allreT, 2019 t GT-1.91% ST4T9 3117 ‘ickit CRT ,iiNi;e44 tits...if 12 Tff 2019 WI 4
ticitumi(ut tt ii T aifir(ffffr WU WIttff ftzrr
.ack-p< waT PhsITfacAvievi 311irePi9, 2019
(\iccV IE 31fit1lk<1l1 tit.901 12 9 2019)
‘iccH At3T MUM &rise{ gran Pi
311414TM 349' \sccvt wa-sT flyer t ‘tur-1 9wii mcirr ctr( tg 74
Thul 14zaDviet41S WTh19T t*1 3117 11wiii VidIlfdvafatim41- &t q.i14cr
cm4 war ‘i4 ctreil Thl" cdNMcr gra 30 \ilia iTRIF4Tff ZIT 31-1115ftl
ufuen cin4* f4
i Nivel iTM-4m.lPa1Cf3are4IPT row41 vit
1-0) zig 31Rffk511 \it-yr{ WkT itAt fawatheio, 3TRrffitri1, 2019 06i
flIM-T MWER ‘ick-ff At41 •ou4 it diiiii
TW ttr 124-4j— Th-sr 'cir 6)41( ‘Aiii mr4 titnnhf mild 4 3TRIWET
9N1 Thqcf Th-k I
'sit ii
dirrei 917.
fatcul aM
191 RPH

Hdll [61
mm
mm 12¢; GLOZ W'W 1&3 mm M W 9.11 (L)—L
agmmmgamwwgmgwgmmm
< W
WfiWNMF—Q‘JM
@Ewmwmgmmmm$w&_
‘meéuwhmaaemmmmwwl
(GLOZEAZLWWMM
6‘03 'WWWMH
gh&%6mzkaumwmfimawwmwfimgsm‘ms
mm‘gwgmwr-flmmmemz‘m
memgmmmgoozzgfim$ummwm,, A
BER!
aLoz Lune 9 mime
6L-LL(52)L-6L—L-g;-6L/tsu um: .
L—lLlhEle ml
mu: man my;
lam: m mu '9; mm:
A aw: 1mm»: 9 mum-11¢ mum-1
(W man ma)
(9!) m 't—mu.
WW
_ wmmmsgnm
9L—vLoz/ Le—oglohh/o‘iga
om/owofiom—me " ' - ‘ (z—a) LSL—mhyz
r
2 • ckV 'Cita 31311z11VI 1
I ,ld, 6 317-49, 2019
2-74c1cP 3:1- '4 31/2 3TRTT 361/2146. 9 er, Tfr 3T1Tikall ti•—
(m) 14114RtIc ml 'iffecRI faiflinevitr e flinnPne, t t;
(u) "artrF ITF-43 uer)-114 far TrItyc (-
7031rotrOtr40) ml
3r-ozrzi attra- #T-{drzr der-TA %LT Trftr; zare4qTr, 1987
am-fr3 wrIt3 3TtIFITRePT der-1(14 ftar nRnq t t;
(Tr) "44" ml MKZI. %cifatlicitf tichia N1.4 aN f*ilvirr 6414 zrr
ittt arR:r t;
(Er) "linker-74 aftztrfir- atIttTr9- TrftErc (tio7to3Trta31R0)
ml
3-r- 4 linker t afittrlir-w ar-dtzTrff TritEr4,
f1I t t
*NON. * lcb f414 noierni arRrwiTrr t ;
(3) tl-IPT" WI UrecRt it311/2 31t21379. ftiTrn- t t intr14 artzrzm at)7
3T-gfr-Tr9 irq t;
tkaier" wr 3T-jr4 ThR Il, c rr fliiiew T ;R119 ZIT
wiTet ar-Tettetd- flf ervi em4
1A-Ther
vLreo t t;
(as) fa-am 0 silake$1- ml cnwd c•-q W
74 iileilfle61 itTrir t t;
(7) w4-1. # Rzeria.wew W arEzrzr9- 3-R-Tr alarm-
437 er tuReirq
t;
etneinRus ml 3r314 -%aflinevr S ern4 TrNwc tit;
tierni mlur3r4 -%eiflinew tierni t t;
(z) "util kwrzr" Tr .rno:rzi 1W-1 Act) ThwrzT gkr if&-r
(3) villentr Tr urerzi fc1IEJlcl4 h arif4zir/vi T
1.91-)nenii t t;
(g) riwl Ttit zr--Ottn- Tritic (antotRoarRo) ml 3r3r4
ITR-dta 3T-Ittim Trftrc t t;
(3) "t-o_tr9- /me4 ml 3Tc'4 3TR1kac3 7t1T Erfarrti T
ar-IRTR fderflinevi wifita- est tr-mr9- zrr tclrf t;
(uo "ITrar 9i4>etir nPas (trialt031Tt0) ml iffecli 9ffetz1
1-Svi11 1011; 1956 9.16-ff 1-1T3tiT Wa>cfir ITRISfq
tf t;
(ff) narFS Rxardview wr uwrzl \law W
tulitw araTar Trrzrrzfr aTS akr -{P-Trferu f4-4r
lq1 ici4 t t;
(er) '`uttzr tcrelier-r 74 P--Trzr# nPtiq (7ffo7o7alio) Tr 3r-ozr4
sa1410.4 rut--r 74 vmrzrff 141444 t ;
-RTEerzr ttu (krotiotto) ml 3rez4zl-ttazr ei>3e. e1,1 tr
t;
(el)
1tq 3zn4 91w Trftsrc" (73ot10-er*) wr 3T-ozrzf .6t4
31UI1tI45 QM% 1-1Pq4 3Tie4-49,. 1993 5 31111/29 SM PeRT
ftraTr tritrq t t ;
19I_RPH Data 4 Vidbaika Folder (Adhiniyam_2019)

‘ WWWW,6M,2019
Wfimafimafi,gfimfiwfi—
WW 2—mam
(a?) MWmmWfiWfi‘s‘
(a) "31% W W firm may momofib’aoéo) m
mmmmfimmmfimwew
mmmwmfifimmm; V
(11) "mimfimfiwfimmfimafisfivfimfifiafiém
Wmfiéfii
(2:) WW afiahfiras mafia]?! um" mowmom) an
WWWWWWJ‘émfi’E‘Gfl
(111) "main fififin um?" (wofitosnéo)
WW,1956$W$H111%H WWW
13f %; ,
(a) ”We; WWW” w awn? W W'W a}
W arm 3mm W11?! W W wnffia W fififi
WW fir %;
(a) ‘Wifiu 1mm 'qa' mm WRETWOQOQOfio) am am -
W W vii W qfiq'r: fit a) ;
(a) ' 3%? am“ (Gomofiro) an afimmifiu 33%? am 1?
‘5‘; ' '
(a) "W W W W" (wofioafios‘o) WW W11
WWWW..1993$WWW
WWWEWE‘; - -
’191_RPHADava 4 Vidhaika Folder (Adhiniyam_20]9)
cri Tra3T 31311T-1Tar I'4 C, 6 31-93?r, 2019 3
(9) ̀Rverei to! (q9okrFokreo) miord 3rE1zr cir
t t ;
(g) "FR-et-4 *it trthic (4tattotto) i ffriazi iiredter 4er-a
14Rt14 arRAzpi, 1948 met tiTT1 4 W artirff iffsd-ff lirdrzr qift
treorc 31/2 t ;
(1;0 Ta-rfercrit zrr arEzreLi ufa yo-arcrf zrr uErrezier, ci3d4R1
S terq14 451 dfad -ncinc.nerzr W
w,a-ergt: zrr "31alei crvAgRi Tir ugrEzrear,
c8(1444k ";ift 'V44" t t;
"ffftd." ur ffr-ozrzi tiRke-pii 5ra faro- ;
(#) "300-0 4k m<bixi4f 051 ffriazi Ro14.41d4 W arfkke 3.0
wm-rvrt t t;
(Tr) Rkqiiict) ffiwrir TT ifflezfd W-4rzr ,4-Ncw
kr writa tiMcr) Awrzli t t ?Tur Rcifasnew 3r-1-4-rff
airzrrir th-frW Sifu 3TRifF In 09401 their *Eric,
s-dizr rw<t)R4Rier, var their trthi, lirierzr eciff-a)pdr
trfterc, 'skit irftffth M4>mi 3itt-zr
ar.zrrcrw their gffirc, W-41zr lircerzr fla)c-th trthr uP_Tr
Erthrc ;
(zi) "31-130" osi wroTzi arRre4zr# t tidirr t;
(q)co) Tfr arRA-zpi 309 3P-Trierff WAT Rzlidtriertr t
Trizrfra-d niwAluico ffiwrzr" wr ii4:-
(l.<r)) .4)tipia 'd- r)c.Muf 3n4ZPT, 1860 (3rf1eliTIT
titstll 21 39 1860) T 3TEIT9. •4- Octi.c1 ft3it
t t ;
(t) 2TR&Zi affefri3171, 1882 (31idkEPT tItstli 2
39 1882) T 34-9. 4.**
-gig 31/2 t ;
( -f) Tillt 3TREftql3, 2013 (3T1S111 titsqf 8 39
2013) T 3T49 •?10co- mirgt
t ;
(q'.4) itiRPqfllt" 4k "arezrrtzr1" S Rf)qiiI" 11 M-0:14
0n9414 TEIM fazincriew W 509Y11 ,
"3Tarratt" 47 f1i)14f t;
faNkeriew WA mt;
(q)t.r) idxcifaview W 421T445" 451 WrOc44 3TM-711, 31Eall,
tI61L14) 3TNI41 5 31-41 ar11vp4 t,
1xci11tilcier 3#4E.Tt arle# zrr Ati
ttrAcr crn4 Throw 14,e.ir u114 3tt3 31UTIk`411
arezircrwl W Tizr tr-4-rftrita- faVir \3114;
(<ths) w'remzrei", "fdth aiRrwrer, "gfteir
Pip-icp , eig-irwr-d-zrrEzrei" zrr cgoilerNico OYI ffrozref,
Rec114rmi1 W ç Ij a1VTL ctritAcr, ug crieitAcr,
qccl 3TRI514, gterrr TiTrwrwrizzrei zrr
cgoilxntio t;
1 9I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

Wmmmmwmmzms " 3
Ff) W“??? W firm" (Wowowo) fil am "@321 W
m%%;
(u) "HR—cm Mafia—q” (lfiofiofio) mam? W W
lufifimfim, 19483379RT4$31WWWW
Wfié‘;
(t5) ”Zmrrfiimma “fiWfimmfi' ”W
a
afi?”fifirwfi“fiffimmzfiwfimmfi
'afirrifiqffi'mwama 'ufifimfiufimmfl",
"W“sfivwfirmfir“ QE‘;
(:0 "ma'mmmmmmam;
(l1) ”WWW mmmmfimsm
Withfié;
(l1) ”“fifimnfififira mWW—mwfifififlm
mwfifiwfif‘afififirzfifi? 21241th
Wham—c3 mmmmmm_
' mefimwgwfimmmmafifim
, m,mwmflmfimmm
, Wmanqfiwq, WWWWW
WWWWE‘; _
(a) "W“firmafisfiafifiwfim"amfifi"é%g
(W) WWfiWWfiN—‘l’rmfi
W “ama‘rTrIfififiWfiIam
(V25) WWW 1860(3r1i1fi1111
W21W1860)$WWW
Wfifi;
(3r) WWW, 1882 (sz
1131582)?» aim—«I'm 1am waifififi
Rmfié;
(25h?) WW,2013(3WW8W
2013) fimfifimmfimfi
fi‘a‘;
()fifififlafivmsfivfimfirmfi
manila Wfifiw: NW,
“31W“ cm “W“ 11 E’;
, (3W) 'Wfilfimfifimfiflmfimfimwfié'
f (fiat) 'fimfimmfiawmfi’w'firammmmm’f
Wmmwmmfiz Rd?
mammmmmmm
mmfimfigfifimmsfivmfi
gm 31W fi fit: FT Wfl‘fifi Ifim Gnu;
(W) MW, "1W2! "fifi awfiIfiriT', “firm
mafia 'W In ”'W' fir am,
Wfifififififimfi,mfiawwfia_
13a afifirfi, when filmfi ma 2:1
Wiié‘;
191_RPH_Dala 4 Vidhaika Foldar (Adhiuiyam_2019)
ftrarst mri
ierrcriT fac
srd
Trata 3R11z17131. TWZ, 6 NWT, 2019
(OA qYcl1av.4 Mg" TT moiti *tf 31-141k4/1 T
3T419 Tmfta
zu -1 ,11kr iWt Mi -Rxcifaview t;
(coto) Thcifawcia arla-ra &ROT" TT ffiecrd
KVA
31T419 31ITMIT 3TRPTER '1956 Si tTTRT-4 T 309
-
wrieTu fct1WIici4 39419 arr t;
alfeng T 314-9. 1)Yclfasficia Wem cM4
'Wyk
Iricr vict) ftca qi-ifZINcr 714tj4lT-TaT
312Tiq
k9-arl 5 ( cTik) cM14 W:1-3/4 . v-TRTT thTB
fRr Tiftu
coeir ;
(w) facifamerct itfta arreRt et51 T1 wr cfle ct)4
stem aliflur at w 4)4 T`i tic14-1 t14-eict),
'Tcf Enftd ctr0-11 :
WTI zig fi15 11111‘rIch ffiTTRT, fkci1&eW
ti °Hell tg tRit IP war ze-* Wet S ara
ftwzr, amar WT 41. ct)+11 3fr. &Rena
li
.3 evr cral—Ael v-znwe we-
c wrara
co :
(T)
(a)
(t)
(t)
trR9 AT ci vid4 errfita ctre)- tg
fl fkel faR aitfra 'tor ;me cm fatel ;taw
-1?) wrIzra act) 74 fa-azr TrTee MAI and
*TT -161 TaT vIlaTIT
tgu‘ (RII) qRte giftr izr7 t m--a -(4 .9 $,AK 41t1
T al-IT5F ITT4ffiTh91ui weir, fRPm-a w:r
TWI ;A.m. &4-Th-F 51 vcrzfriT telPlci) VNI '14Ylki ch
TRI'l791 fa)ce au;
ta (RKr) ti 1M@ aaa coialercrl afrZ iiAiimiiafi
W4aTT 2 N') 4TI t)44 3itctr1, cpPie,/, TAIW,
W15 (u) Trael f# alcititurnotcp Tilautti
u‘arr 3TRT 3WT 3417 *R. \wit)..,er intoind weir
aTTITTIft ETIT4 TIT k ‘Tff-dR 6 030 T-Tqi ‘ing4 w4441,cc,
auRaar 1tIarcietcpiicitw Ti-fter pa-e-ga (et) If
ed .11-49 thn-Rl ThaTT 3W1 3t \3`141)`10
ctre)- .3qcoer -wfaccAcr ctreir;
itara zusitwIf W*41.tcp ft-cal gm eurfrea
maral, Trt—arraral nu igieicl, 3TrATtil afr 961qq)
ch4T1iRI-4 TrT4TeT Tar Nrdu cP'MII v-1T faap-rimtir If
Th'I .513 it-cr6cc1'( ard-Tra PiWf 31UT1EE5 facifUgcleT T
-RaRcr co4-cw1 ;
T‘icoicicr gq Te (INA ‘1/4)Lia Tieq4 TiffT a
72IT 311EITTO TTTERT91 zMTtt q),MI :
tirt /Tg. Te ciit4 aro # writ 614 4t ‘Tra
Te-a alt mpr aft;
191 RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

asfiagisus as“: 22%; .. 5.51:“.me
mgfiwggmwfififi
wgfi¢fiia§w§wamfimagwg
. .EwfifiEEEE
wfifimfifiwgwfiggfifié
EMEEE
fiEEEEEwwfifiw
«EWEEE_EEE%EwWEE
E %E EEEIMW .E
EEEEEEmEEEEE
EEEHVEEKEE
.EE.E§.E.E@EEENE
afifiéAéEwEwfiauEE
MEEEMNE
Egg EEEEE
E¢E¢E.E££EE«EE¢
Kefizfipfifififlyfigawwmaigg
. Efisfiwfiwfiwm
figgfiawghfiflwwwmgwfifi
EE.£¢EE§§%EEE
EEEEE&%EE
HE
Eégfiwfifiuggwfimfiumflfim
rgfifiwgcfifiwE§5E_E
EEEEEEEKWEEEE
«w E .E E we ma E A
EEwwEfiEEEmmwafimEE
EEEWEEREEEwEE.
“E
Evaagfifififlwwfiwgvmg
,ImEasdrrmExwwspflflwfifiEE Ewing
EfiEfiEEEfiwfiwwgn—QSWE «WEE
MEEEEEE
£5 w TEE an 822% ENE, Ewma
.% E E :Fch £me Ea: Emu
E
E
E
WW
ITe7T 317R1Ruf 41v1( 6 3171i?1, 2019
039 faf4=414q) -ftwrztt iTr4m1W arl-frR to-r-11- *fk 4gq4u7
14fW, M-4 TrftftRrzil, wq-Th-g-rq
cask s14lck-01 oi4m41, vrtfrzr 1)c1i
uur irtfrzr ci>3e ctk M um-ferr cm41;
ElleM 3r-Imr9- arghTr, 3TRN irrrerzt flt ftrair
ettc, lflrzr wrv crth4ftier zrr •?ikro \i-ww gir
v-Trfetff 3Kr fa1414ict, f4wrzil gkr fkliftff Trr-4m1 Rr4
fare-49). ar-1-€cr 04E;
(r) Rzcifeareio W <4,4-rgNI U21-I 31U17:1-0 S• lasEr f414
wrRm cmir uur arr 40(q4IuIcpI. 4h- 9-iq ut cN.11;
faY114.41e14 Th MYIN-11aftch145011AS 1 qq,
3TRIF4̀ W aftvth49. E14r4r ;
(z) view gm met Tr4 444 arwarr sarr4zFr uqr
14zwict) W wcrnfr awiTra 46I thift;
wog we( Eu4711 g-ndsv-!;;;Xl, ?Pim <mil atIv
caNifict, ffiTh-Rn sir-kJ ar4Frfs-ff4i m3r cmir;
(z) mrio tww gm A14ff crrFcr 3frZ vitt IR msr
'1-49T \311c1a1 cbNj1;
(Z) taftrw cMuet, loqr •11co4 W ;Wet trtaTraff,
-crrf4zil sithur-tr-4r &ft W f• it1cOH gkr 2.Trfr2rff
9i4 311rra-9. cfroir;
(DT) lI weiz1 g-a-zr urar metfr tkimr met turg-sfi ezrr uP_Tr
9110 TT fa14-r4o siav RFM-zrr !ITM 04 W -rz)-Trr
uqr st1Ic1,414co fm-zrr 4lIIII I Travr t5T 31I 14tm, t1191-4
tufetrw cte)u.5. 3iTTR $)lit
itatt iimet ;rev wr 14-cra f4ifkiider met
col 4Rtic gkr ?Mar iv<tv war 11kt1i9cP
f4wrzhin aitraff 9rr-4w1 W ai-j-€0r fl;
(ff) zrarrealto- tg91-4 teTkw <t)cuss•( wr aufrTur cotir ;
(24) *tr arfe4zrii ar-vrr ‘,11 ar- r wl cm.4 wr d'irm
A6 r cm-g, R -Twr \TN/Pi gro faxcifacmou met iv-}Timr
W 3ItfThitd- fWzrr u114 ;
q.NRWeietS WRTR Thtw3Pa1di 9TIT t
ain<bewr <m4 zrr \iicorTrizr-49 cm4
utofr tevr aN 9 tt ufrmet arlar wr cl-(44
*911 faxcincriegr trrz1 TR) it-er fIiitegg W Ififla
Rgfatudif wirffm .14,4 A14 met ThT I51 Tr-g-r \JcPettirr
41,11 '41 P11 att? It<q)N- ft al1)e4tm zrr Ici14-14 Rqm
fer W 3T-Tirv mi4crig1mtirmIt t
(q)
/91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWm,e-W,2o19 ‘ 5'
(E) WW$W$WW$WW
W, mm. film: W, ma—fima
WNW, W mm aa—azqfi, W W 21151:"
wmfiaafivafiwm;
(a) mwm,mmmaam
W,Wmmammmmwm
Wwfifimfiwfimfiafifimwfi
afivfifimfiaha—gws‘mg
(31) flammaEWTfiaTammzfimnfimfifi
Wmawmmmmwm;
(a) W$WWW$WW,
WWWW;
(a) Wmfififiéwwmw
‘ ‘ ammzsmamaam;
(a), 1.3m"??? WWW Wm m 's'fiq
Wmfizmfifimamqfifitfifimfizfim;
(a) mmmwfiafimafivwwmwfir
WWW;
(a) Wfiafimafimmfiafi$wfiuflmfim
WWW—mafia3mmmmwfifi
WWWW; '
(U1) Wfimwmmfimmw
wwfifimmmmgfiifiqfimwfim
WWWWIWWWWW
WWEEWWI
mwwmtfifimmfiwfimafi
WWWWWWWWW
Wmafimfiawmafi$awfivm
(a) Wmfimmmmmwfiv
(91) flflffifimfimmmfiafiwmwm
mm,fiwf$mmmgmfieafiamafiwm
mammamm;
(a)fi3afia1m$ufiwa§wfimmfi¥afia1m$wfi
'mefimmmmfifififi
maammfimaammfimw
filfimfiamfimfinfifififififimmzfimfi,
Wmmwwmmwmm
m$mm¢mmmmzz:
lQLRPHiDava 4 Vidhaika Folder (Adhiniyam‘2019)
6 tit41 3RiTtTIPT 41\31d, 6 31TR?f, 2019
4-(1) ct'l. fcl1kfle14 i-.24f#4 cm4 vmw at)7i.iR4iiii ftt8 t
aa 344-44, wilutu) .ft-S1 g 194-'114 .97 'flutf *NOK kf ?Mr
fAtlifta 31*-49- tk4)Isf Th-sf 1;137' few -r-44t I
(2) 1-1PLI1u1.11 134)-8 A f*ri I atm-fktz tTft, atztr4,
Au) Thm-r4 ilicot,a wr 1-t4t
144-dlcooi 94-Hur--44 -414-R-41 S't ea-el tik
R-t-rgiirf4-4R-ur;
9141.iu, ffim-r4 -14-4Rr 3-4311ET91 t TRZAT vL44-r toa
cl'hi -tt aut Elam- Aur;
w*ciiRkt fiI1iettT in 4r# wr4;
zu viciLr wq-474;
gifk met cr--g-&-m-r aft? Tat uzTr <NV TP110-1411 3:01Tatt in
fkTuT afr iftq-M 1za ,K1iPc-4 ;cm cr)4 424 Nit4
A14 q wtciiPlci at:r 31n MT foRIPT;
qzoRiviou gki \3454#(-1 -,Itt 1 /43-H4tcj;itciaci 3tt21Zr4 4-21T
39-4_44 M u)144)41 met vTffi 4-24 d.icbI Usk 3117
fam-rt 9Ri4 wif 4-24-r fulvirt toat arruam-4-ra4f
9-4mer mitiRsor 347Lii ct9cW. rii4icorr .a4t WI
ITN t 31f4T* uicni44)41 m-sr -cHulucg %-trr ;
attzum 4%4 31arrv4m7 u)41-uiNI tik 11*ciiIlct tafferr
3futTraftin fu-aqur ;
vrt# tt4 A14 k i.i'tciiRlct -ffeutrrq, 141,41474i mil atTlas;
;4j ffimizt itt31-1etT TRAM sTrurail at-144 4-zu
faz ;
zf cifZjci4 itt. ibii1ef614 t9d 4IIlcl6u1RI ‘31 I
cll ErWRi rum-rt 4Y-A4131l in foqur zrza--444
31-ruura# Nutkuriims 3tuarQ U2-11
qcm4- 3.Tftin \jyrirf 3.N ;RATE 1TE-4 qui
<PI ;
arri-r4t 414 au i ftii*ciiRkf 01Td- # wolucg
vItar4;
1RT4 met ?4--A4-r Tre8-4 Thib4t t cr u4met egrTra
civicr ttetij5 ikfiici4 met ;
vzi4 timem 44 4 gzonvidet Ztrra:4-e4i 3i
qr<4 t-g 31-cff;41 vi 14 uRIT vmreaff vurr-4t;
fazu1dvio4 4 31tificfa Sr4 3TM ct4T-11Rt4 1 ffizifivr
s 3n9-01 ui vmrl'44- vcrrrt ;
itt
Yøra1Ie1CThar
7eirCf9T
Tferra ;77
1.4)w u11.11
(w)
(TO
(1:0
(z)
191_RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

(mot—MIMWNPV) ”PIN wwm v EIBG'HJM‘IGI
A fwwwwwm
gwfigawwm Wigwam
fwwwwwfiam—ma
Mflamemwn‘emgammmktwwwm
fwwmwgawgamm
‘mewaamlaewmwmm
< < fawn
mwzae’mmwmgnmmw
- 5W
M’wgmwmhwmmww
MWW'WEQELBQJRREM
'MMM‘MWJQKRWEEMQEMw
wmmewfi‘haw—MLQW
. fmamgl
Mmegmmwmwggmggw
' flatnel—‘Emmfl
$213536 nan-m 9% W W m mutate
5MMW¥EW®Q$WE¥EE¢
mggfiwammmww
Eammmgymmwmgmawmg
Qamhuemmmwgewazmm
mmwfigwwwmpmgbme
fmmwmmmggjmfiggm
mmmwmwmammfiwm
. 5mm 1112:2921;
WWWfiWmEEh-Mmm
wgfimammhmagww (91)
‘3W'WWWWQMWW
mm:
Im‘mgflmgmmmmgmmw Mum
mnmfimmmfl—m‘mfimflw‘ww $31M
WWWMEMWWMUH {mm
._1¢____d___________________—
BLOZ 'LELLLK) 91m; EMBLEM? MM ‘ 9 _
kicth *4T .31371WRui 1hJ 6 3TITRI, 2019
timer ml zt-r4R1 arraizrm—dir3ft tiiiiirfterd
crii 04i 'i4cpflkf cm•)- mi -34,micr t tiR Hr t w-caTET
Eled faalatrievr grd ir+-t uti4 cii11t1t1Z
3itzrror9, RftraToir TIT 39-+IVIff 3Tizr4St S
N cr1 fclII€jIei4 TrA, Tretairall war wr41-zr w-drril
931149.1 4)14 .cni4co4i 34,h-dad <m4 A iii4 t, LIR
-NAT ;N-gai %-zrr ;
(u) aer—qi,4 kr4 Thni7-1 war tilqacd,r ThflhFtdIq ZtTkr9otrotio,
kr9trcr4T01-10, •41cH 34rft 31Ita fthl
Ilt-11141 Thnw uur TzlitTrail 45Titaizur;
\3ccritod1, 441a cr>1 w-aziar;
(ET) 44 arR:r f4A-oir, fim-PT air t4i;
(9) 1t4Rui, thiT kb flv4 tkct)k. TR
faPP-ch'r ft-zrr ,tizr
5-(1) -ft# fclIIclLI SaTiENT g tiR41mir REIV TIPP. TWIN.
ATW1 &ik 117 tiVOK ml 3t-ri tell faTITTT 140 a Tad.
trt
‘3h-N. 1laY1 Cile14 SR, 1973 3141-9 wirfird
itt 'dug .gct, cgcla;
(U) tHchls1 gkr -11311*atd Threi fazcifatiiertr miict> arwrzl;
(Tr) \Rck :i141 at 3tr4;7t ,31-u1t ml 144)
31-RiT4t ;
(zr) \ihy
kr4 ifThici,
striT9 cr-) arRrAt;
(u) Tri41/2Tu Triz iftif*atd 141-t1
TrriiRtz. -A *oft t arRrAt ;
,flve4 gkr ll11f1tc \icdsz . 14 w •4i,rer Elle14
Sf, 1973 Tenfiti ffi9it facliaslicie-i mi
ciptIfcl I
a SlItilvIci) ffiszi 5 frAzi S MIT
litdifad faxufavida ziP.TrRrff cm4 Su-fra timpit zitrzydir tiro 1IcI IM
14R441vii1 Rit8 ER mtft
Tritfa ;WEN ffaTT 111411v1-11 13.08 117 WAR ctr< t1114 siizrYw
tf 311 Trgrg, Tizr edi TirTra, TriTr
Trat ti
311:14 410-i t 03 31-ef Atm. •Iver
tItichk \tug ftur fallirTr A &Emir f3Err8 c9u mtft:
zeg iR faria -13r if a %z1 oi
f$41 ERTIwf t \UM 03 9I6S ava *AM 347tREr1-8 wtcjcl
\LI arErt REM<Iv4 tkcnisr \3t-4 ftraiir fai9r9 4t sw-diz 0.1 I1Szrr
tAsr ara lui44 \LNOK 510 31-11M A ii M 41-ff SiTir
3wdt t
1-H•NI Zig 31.1 zarrizr9 isrrzi4T 614 1,yer tkcw
arra-al* 349 Taff %-fft zritit gki fa,a it 1MtaTur, 3tItITTE (1) 3ittr9
iRTFITft 5NI 14,a Tit ffitevir t194 Atti
(7)
rqicb-r
gm ;WM Thi
4-stlich-f Ur
krf I -IF
191_RPF1_Data 4 Vidnaika Folder (Adhiniyam_2019)

BC—VR’ W.W TIRE, 6 W, 2019
(W) mfiaafiammwfiammsfifimfiafié
WWWWWRURW§WWW
fifimmmmmmmfim
W,WWWMWE§W§
‘(fi) wfiwfimmmagwafi,nfimsfiwwfiuwfi7fifi
W%fimmwmfim;
(91) W—mqfiafimwwfimfimmuumwofioqfio,
WOWOWO,WWWW%QWWWW
mammmmmwafimm;
'(3) Wamwféafiéafimmfiawflw;
(ET) Qfimfimw,fimmfizfifiifiméfi1fifi;
(H) fimfiamtfiw%mWWW—Ww
'fififiafimml
Huffirmfiraafimafiwmfigqfimmfimémw
Wfifiwmwmafifirmfimwmnfifim,fi
WW:—
(:5) WmmfiwfiammmwsaEmfifiwfia
Wwfiaafimmmwm;
(a) mwmmfiemfimflmmwmfi;
(1T) WWWfiWWfiWMWW
W; .
(U) WWW$WWW¢W$WW$§
mama-mam;
(2‘?) WWEEWWWWWW
Wfifivfifiafimw_m;
(a) WWWWW'WWW
W1973$Wwfififirfifimfimmw
WI
mmmmfima‘fifififiamsfivanfifififim
mmmmafimwmmww
'qfiafimfiqfiéwfiafiafivfil
(DWWHQHWWWWWWW
WfiWWW memfimafiam 1mm
W?!
(4)Hfifi,»mm$fimmfi03mgafiaafizfiwfimw
Wfifimmfimfiufimfiamz
Wflfifi5flfifififi, Wmfimmmm
wmmfimoamafimifiafimqufiafim
'Hfiafimmfimwzfiafifimfiwafimmmm
mmw1$mmmmaamfim,$wmam
WE}:
mfimfiswmfim$wafi$gfimm$
m¢mnfiammmmmmmmomm
mwmmmmmmmmi
l9l RPH Data4 Vidbaika Foldcr(Adhiniyam 20l9)
8
'cc'( Slt4T 31331tINIT talc, 6 3TTTWE, 2019
6-(1)0T 5 T 3TO19 iTtd. 3TECQATIII1c1 6 T
ittchK wr Trg Trwtrr4 Aim fbcriasficia met wrcr-i-r .D,qr .41.11
attercLuf t arrvizr-tm .101 vr Trm-01 1
.(2)14m)vI4h NTTzf URI 3 # faRfatd aTeraTraft 30 idT &r IA 0 if
lo-4 tkOH r 3-frteT 3911T-09 airccrr gro-vrcr2T-Er W 342T atrzrzr-rm
.W# \414 W f4-9-fw aitrw-d4 wi met 3NRI T AN7 AWF ct) 411 I
(3) gra -sw.fluRn f4TRI gRT 3 T. 3crectf TT 39111-g9- cm4 If fdm-a-
I Thrti t1ch1•1 uv4.ict) Picvi M .wtr it4 Tr? 31-RTZHICN Cb) -Per
*4 CA vrWr um 61,11r
7-M1M 3 T 3TON AWIff 3171-6-9 31TECT 117 1a-17 0•<4 LR-clIcf
iR 'i'i ‘11'ct)k 5I Tft RTHWAT9 1 /431icif t ffi5 llizi)u10 ffiTTE! TNT 6 .4
ucrtiwr (i) W wr 3ticrr-64 fiwzrr fl'r crg wwritm 344-4,F9-r
gkf ai1tzrzr-T5 31TIR 9T11 WAN tkAcr aro) met qcifhtieitr msr
ar-v-r t *Roo' 1
*f 34MPR 3019 Wilferd• r0-if v114 cila 9t "WcIratlicigAl
9-111, 6‘1-1 aSr TWIN <mc •411411cr ft-4 -r4-4 I
fa 1-asi ir14 wdt tit .414 W qz-cricr w writd JPuiwi W
mre-f tk0k- gkl• 3fItNRATT T 30T tici4-1 3Nlit 2 If \31-kiRqd 3011
fiRviertr W tilt) arirr 0910 q:ta W411- I
i 31t4ftzPi 3Taif9- WITTferff TIT I 1:1- 1TfRlVid4 1,0
IIPid MWRI 6)111I
8-3110 1 #rnsiiRci f€iii fciPIwew, *tr W amfr9
.Pqfkr §c 4T4
9- xci IId f9t1 16ifkiiet4 31t1T itinr W
faxlisfifok W f4f#-ifi- .16 I rl
ro-facifavreitr W wcts-4, tar mer \•411 xiitgraft,
3-ffrO, ar-Itzr, *2! 30 ftiffRtR1# 3-Pa1r3ll metZZJ41Q41 4,4 snit 7-4
wr 141p'( atIz arf49-It cor 6141 ait 1cr1av.ricv4 ETNI any alarrErml msr
W Tr-d--44 W fr 34-r-azrw cljc1Ic4ur 3Th 1-1t.44 14qirr ctro) IT
tizfRi c0J11:-
3TWITT—la MT
fkin unir
att I4H4 um)
9N1
arjrfia7 3TT&I1
WV RI5T11 oll-11
9t 441 ?AIM
mcf wrcm-r 3121-41
MTIFF
Yr! aficli4
ffiTPR
ellair5c11 1ktr
redt)TA
Yel alloW
30`/41
•
(m) %au If 311749•-41wRIPT 141cs,q09. . mer 3TWIN
9-1tren 3t17 3rr9--d-r-4-#‘44 jyrffrth, 141kd- vitvirr,
ftur ar:r Ift 1-4cr mer treatil
cialccr W f4m-ruiT 4r4 witcr l jc;
thfkIN YTM1131-1 If31aRN;
(ii) 3T-<sT1J1 3Ttzrzr4 ;
(Er) TzazT -q<61<rwir, ts-r4F4u, 014-Aardr, tii98 \941m1cir afrz
3r-Rttfrzr 31-‘744 7-4 fOcr)cir Tr2ict,4
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

311311—4131 W
WWW-
mm
mm
mafimm.
am
afimwaw
W w W TTTrI'c', dame, 2019
-641)m5'$mw%fifififiafimwsifi$qfimufiz
mmmwwfifimfléfimafimfimm
W‘s‘afia‘sm—wmaflmh
(mmmumafififififimmafisfivmfafilflafim
WWWfimWWW—WHEWW—w
mmmfimfimfifiafimfiwfimwml
’(3)fimmmafimmmmfifiw
mém,mwmfimfimfimfinfim—wfim
afiafimfifimfia‘ml
Humazémfifiwagmmmwfififimzfim
afiwwwafimfiméfismfiwfiifimfiweafi
W(1)$Wavla§qmfim%fiiagmfimfimamfiam
mm—wfimfimmwfimfifimfifiafimfi
Wéwill
(2)wmfiflfi$wfifiwfifififiififimflfififififlm$
w,wafifiwfiwfimma§fififimfififififim
(3)‘fisafimmwrfifififiafifi$vwmqamfiafiwfimm$
WWWWWWEBWWWQfiWW
Wfimmmwmm:
(mefl'HEFGIEfiWWWWIWWW
Wfimafiml
8W1fimrfififianmfisafiw, wafifimzfimfifi
Wgnfiafifil
9—W, W Rafi—wan 312m W afr W E?»
WEBWWTE‘WWI
_ 1mfisafiaréa$efimfimafififiwfifi$azvfia
W,fisaém,¥fiasfivfiww&fi§fiumfiafiwwm,ww
Wammmmmmmmmamm
WEBWEBWWWWWWWW
WWW— ,
(E5)f§1&fl I3f Wm M Wafi Wm, 319mm,
913mm 3T1? Win-i=1, fimfif afidcflsfi uh, Wu E13141,
WMWWWHEWQfi fiafimfiafim
WW$W$WWWWW€IWg
(E) stfifiw;
(W) Wm;
(H) W W. W, Wear, mm; m an:
WWWWWI ,
19I_RPH7Dala 4 Vidhaika Folder (Adhiniyamjfllé)
\ickt( liaz131FIWITT 4luid, 6 317Fir, 2019
11-farIcl) .1Th-T9). 3117 tkc0r1 gki 'Wig-Wig TR• Zle
I'd Al Ole) forr-M01nuin+11.11- artzerff facAutcria W
f*-ARgcr iFttTit, 3T240:-
(w) 14rr A 701 -070341, view wro-tma trq
arwifta co4, ftrawr wr acrw4T <m-ir 3fi7 VNT aar
vii-r 3frAT4-rzm aftyitiZJ -14tIH f41im a4r4-4-T
emli, •
() Rca A \ill -sikgrafr, ftiv -1- 14.ricier t3tu 31/2-41,
Item A aurr4T 4)*-11 afrz tinu v -r t1 &WS 44
t Mitrm utrweer groir;
(Tr) friir11-41 74 ucwicr alwriawl vitt0 41u1Pe,0
Sr 3:1 ormr;
(Er) 01 W artfra •?6,4 F cricig arawfb. w3,
cerDvNI urfter te-gicrp-r zrr Thei Wit 31-1 LicgRr
arraR trq u 4iii11-T:ra acrrIt ZU 3TI te•Tgfrw
frittc114 9-419 grfrir 30 a 30 ueificr wr3Tril 31 /2 431 /2
f3teil9r, w0r-IT131 iIuT aM taffitrw fdPitenrarl
• c)Ir;
(a) pier ti,«W 1:0 39*-4-ff t 41114 \ivair TT 3TRT
A-4N ctr011;
fa4119<t) Writt-Tan 3t17 l‘r4 11•401•Z 91-1 3FITIR
Pa0co tr-41, award tr--41, 3:rg- &raid tr41, *16114) rg-Ri 1:0
aM faYgnacig ir arcl-Rra avzi artarcm war &Pit tit
30:4P-Ta crroir 31)7 dcf)Pcrr R1kiii cbtll;
1ci14cpcp114 30 3T- 1 ITO wr 3179 /roil war
tp PPozir tr,frir;
(w) fth-01 f4ifasucia Zn t1.41CH tjWRfrff cia4C1e4
f:= 4 raftrTz vrr tr, A war 04 31 /2 ?Tr itt faRRte,
ara W f4zsa 0•011 ZIT epifra;
(sr) i aM ittra W fcifavrievr zrr ui ar
0•PAT 31 /2 44 014 31 /2 30 01 /2 cr41-A- ffiq ‘1-ir
YRcif€jictx raft 4,4, 3:Fs-A4 <mil, 0-6-410 cr,tir TIT
\3•10)- c1y<•11;
(51) TOT 347 f01411 fdPitacv ug flyileiraft
Zn 3TRI Met wiltr9T 30 ar-134Tur anii,{
Rxcirvicria A wzr 33:r-W içciiA 3rT0 cot1
arrosaw
(z) arta-dr-OW, vilqR-14), 1441164 44-wl aM 111%11%bl
0ftaa cm•-ir 30 3-4 ugi-r <froir; •
(a) arr4r01, w1cr9T, ar-TeTur avz \iicor -gamin
tii U211uoil fq Iar-azr aM .9191-t1
<pc-41.1,01 aqicpentit u cal cfroit;
(a) ar 0cuarl 344-44 anir att7 \nct
3ti-2113T1 zIT Tt-ret M Trmr 431t Urdiv-Ti
ti afz-Acr 61-ir uitir qW&era &maw 'wilt;
faxorauido
01
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

(slot—miéumvv) 19pm mumlm v BIBa'Hdu'Isl
'-MWWM1&@W§
{MMMgmMmmmmMMQmmfi
wwwmmaemmumhwm
‘MWLEEMW
mmmmgwmmmgm
magphwuaemfllte'mnmwkmm'w
Mfizwmwmflfimgmwm
{a ‘m mm we mum @ was rare Lt:
wwwmwummgmwm
.mmzfigagaha
mmnuzga MM h—‘EWW
QMM$WQWJ®$®M$M
mmmmmmwmmmszmwm—
fwnnmmmfighggw
MMLREHWQ @hfimw
wwmgmmmmmw
. immagfugm
gammmaghmwww
MWWNQMWJéE
@MMWMWMWW
Maewahfizmmwwmm
‘Mmznmmgg
.mem mmmghmfiwfigzm mu.
. .uggmm;
L92 LEW 9mm: hue W'M—lfllfifi 'lhufiéi
wawwwwfiwmww
wgammqmmm—mmmmmm
fizaihmwuzwmmmwwmm
SMEQMEWA
immmgm
legnhlfimnuhhuemmmzm
#wmmmwmmmgkm
.m
mamgzmmwgnwwwfi
mgmgznufiagemmwmggagg [51219
-mwwmma@w
WM$WW$WMWW§wmm
W
'etoz'ws‘mmmw
(91)
10 VW* At4T 31.#141-
01 INd, 6 317Ff, 2019 - •
31tre4zr1 wall taNi4 39-trR zmu -ft-Paft \9014, f41-TPT,
-4 TIT tcPcsf QATItrn 1011;
(13T) qY41C11e14 k wata fq mr4r tkcw
arm RRila<t)
f445rz1i 39i1R 91-11 3.74-10ff 43*-11 f -at 314ra
tc-qicp4 zrr Tick-or .tf4ftaa cm4 Etter met -01- arRi
1-Ic9 .11 t Trt-et t;
(a) mem ati 31- 1 SPIT# Mei cl-r•-ir 3417 \ilmr Irma sgicr
0, 4r;
(2.0 afta-rail kr4 araT a1ba IstAI Tri4-4T aramr
cJvjf
tir RxgRegem c1i4 TRt;
(a) %ciRvide4 co4tuN1 3t1-4 mat t atzr aroma
RPeAcr -cmir attR. vola• cmi-tr
argrre4t \i914 cm•-ir .)ttr RciDf.gem arm-zrt
*1.1$11 v114;
(a) fazgRsgew t4.1-cuRql- a-Rrezr tiii-gru te'n'-4
Tria-4-a fq wa-eur s-ir;
(a) Rc1fdego4 cneqm aTa criwr 311 1*4 -crer
ZIT awa- W1rT wr 30ff, wor. 9-4-4T cNir;
(14) zit iriiiaa 1*-11 ft 1‘3.4 *N471* * 10 31-1144ff Warzr
faxilatgew t ft-di aartit zrr ii11,1,a gm ft-4tr 3Taa-
Trie ir f*(1-mu1 zrr \iti4 \iticnr cp14 3Orm-R zrr 6ch 6 4
TIT 31 r-q Tifka ta-g-rt \34 Ejtat -14)m wrz)Tcr;
(m) TIMaT 4T 301 'DA 3TIETR 1zR ti?r 3P-71-13ffl 3114141, %IRRocr
arraral, wazigiaratt, 3mta-1311, Ii4, <riewova, 14Io,44474
3frq amr ceiRot4 mf4zjaa <weir
ll1 C1Id4 tr 317TH cm441I4frf 1141-1
*11;
cli4 amzrzra att wI17 •1gr 051 31-141-A-a crroir att?
96.1 c4r; 30
(a) ttr arm *14th0 mi4 3ft ctisei fdciREficizr t
zrr it41 met urfkr fq arrtat, atustfirt
t16iercr, t
12-0) ftfrr- tent owl:pi-4 uaxf, 31t1f44#, ffctlk 4-414t• 11711
LIP141-114ell aTtirrke 31-1-40 WàT Trfiri%NI artufta
,su gia uftrat 39-4TH ftir wrzlirr
%gfatgc1=4 1f410aa. ft 1clRk1Ie14 gkr TRT# ?St *I
1-11411424 /Wart 914co, Rflelificr, Th-trzN't fazajfari 3T-grw t
artzurt—itom 31-14TU Rzir—M-40 311.40
&P111
za woo Tit
aril aft?
lldicIeifZFtIi t
grIT
13-RY4€11(-14 Tr#1 f?141, inTrff, vIA zu aTf
Om 3N idxgRvicia zit fAtiuicr 614ir ft at DA afro t
fk RA aitrtrer, aurrwt, co4-cuRce-q ticto, Tcr \ittil- Oxi Rv)-
vg4 fq \t<-144 4,14 ca writ cm4 in (461 tr trgoct) cm4
64)41 cm4 EAT foqm zrr aigi-ga met 4,14 Ertam, itr 111 t,
zur zwr arfOrftra
sr'avr
teffor15 111tct)
191_RPH_Dala 4 Vidhaika Folder (Adhiniyam_2019)

(slofwefiwmpv) 19pm wwm tr alea'Hdu‘lol
Hm
maéW—MQWMmfifim-Wfi)
Ikamfiwmwmanmmw'mmaamm
@MMMW%MW&W(¢_
Immmsewamk—m
mwmwmmsamaammmw
w~wfl‘w‘m#wmmm—u
magnum
mW'MM$W@WMm
wgwwmfiwmwmw (n)
‘ mfmmgn
mwmmammwmm (a)
. A w‘
Mkflifimkfiktkfi—‘EWQWQEW
L92 m 225% @ Mm tare km hue Lam—Is
'W'mwafimmmmfimm (9.1)
immwmwgmmmmm
mmmwmwwmmaw
mmmwmww$m
mm¢m£m£$mmsammfian (h)
Emmwhm'wlgzwmm
Aaammemmmmmaammfi$mmm (h)
vimmmhggw
1142M
$mmmh
Lawn
WW
mew
\ic-th 3rflitTRuT , &Ter, 2019
urR--t is fW e aet, aiRrn i.iilRRuf, ro9141 ar-T
feu*ciii ift-t toior4 stuft S ro91.401 SafrfOt Tcr ii' cliii S10114
facnvietif 9 IN't 991 ct,41-coRiI tt 941 30 itt lod,Lict,4
arRaTur, W14H11410 ER ,flv4 dctii M 31-ite PHear-mo- gm
ft9r q-rtrit
14—Rci theta t 4-1 arf4tat 6141:-
0) ceiiIRr 9r 3TEzfei;
(2)-Alt diI1YI IT ZEfialei;
(3) T.:614ft;
(4) lincteillra; .
cgef RTIt-4;
i4M-ft *SET;
IPI-?[ te-z0uf MT .f-0-TzflulaT;
(8) fkkt4TM;
(9) 44t-rfilct);
(1o) 5c-c towntict);
f'd- artreat, AR.
,t). 31w4 3TRMTt 7). LIRP14f giV tiflcf WEI v1I
qVc1aulc-I4 S 3T1IMit, &4i
1541) TarkEllt/31zziei Met fA444 zRTT fte6d. ITFPLET nit fTher-R
af-grm co,“). itr9 94 tt 3f4tr fe4 sffift ffitr-9 gi4 tr
aft
(2) teallia/31ZzleT f flClIcl4 MT WIG 6)1111
(3)TaltlEfffiRTEz1ei u4l MThlzi Met td-et Wall jci11tioi4 M ti11Wt
WIR‘ft Met attterd-r ikiti
tit -4 IT-1?ja cM4 TIT 31-Q1W, 1t virci, 7).
31W4z1M ‘11441 v114, cM4 M LIVUld 441 fsrea \ictin-r It saitrcrffi/artzteT
t-r 99r 611 faY4sile10 M f89 9 9 vftvrrt 19t99. 9-09 t qkz-cia
ciqflf1cct tkuil Zm *ram cm4 q ffiffird afra-4 gi4 warfrgffi/artzteT
3Trata faf4tt fk9ft 01401(4 tlifitc1 6)4 M 114 apyr 13)--0
ffit 06 iitc1f t, tRri rural 9 sotft f9t-r9 tar to-t ti arar449T
yea- 0,e111ULICl/UEIT 2fELT 11T:M
Tru ft nt 999-R-r i oitt9 0I 'ct>4 t -14
ct3cA4R/atate 3r4-4? 1I414 ?tar aril
ctielliql?/3TalkT M ELM PiM11Rsjcf IRWII &i4, iqhi
(m) qxoNencia co14 Tom t off44-41..tt TriTr co•frir ;
(T1) rff 3Itffizill Met tTRT 17 3ERITZT (1) 301# M,FEA Met
ffizi-Wf qn-if ;
(#) T41 3409-99 kr4 9019 99-r4t 941 *j9494
39-4TR. toatiffi Z11 6thir;
(i9) -@11 31:f iPkvii. 1/4A•4r irR1991,4(11 gio feo fi
.roa
(6) rter&-G-t/3rE9t .14cif41ici4 stfacroWila. /44rar& aort.
tc't 99-41* t NS *At 99-Trt 3176-ftd c041 •
laqfE4Ie1.J
antr-sit
tarRfcrfa/
31F211R1
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

8.351555 :2: £25; q amaxznalsfi
_%EEEE¢E%
E%EE\%E%EEE§EEEW@
. :Ew
E§EE&E.EEEE
. MEEEEQ.
EwEEfigfigéfiE
. ME Ema
figéwsgfitgfigfifi
”Egfiésgwfifigfifiv .
1§5EE5§EwE§EEQ
‘ _EEEEEEEEB§\§
@gE.Er§w.E§mfi&§§y
”EwEEEEE
E§%E%EE&E%¢EEE
wfifiggfifivmggfififigrga
EEEEEEEEVWEEEEE
@EngEEmwwfiwEfiEEE
5§\§fifiEE.EE%E.EEE
E.EEE%EESEMWEWE.EE£W€
. _EE§§.E
EwfinwEwwflfimEfiEEmfia\§§
_Efiwmufiwmfiflnwflwas\§€wm~€
Em fiEEE.Ewe§%€E%EEEE
Egan BEEEEEEEGQBEEEAE. .
A . _%.Eswpmfie5
EEEEEEEEEWWAN,
. éwEEE
“ERAS.
LEE? m
{E
v
EE
"4%
AAAA,‘
0')
v
In
9
0
“3“.me
“marmfifiugmmwfiu.
WEBEEE
«WEE A Ifigesfifififigfifié
_ .55E
EEEIEEE$EEEEIE_E§
«EwggwfifififiEEEaEEw
Efifififiggéfigwfigéfig
Efigggggfifig
: mvom.Em~EE§EEK/.Em
N
_‘
VV
12 \icth A:6T 31391gRuf Ij1d, 6 314-i?f, 2019
irr 16-(1) Uri 1-1 /31:11alei ter N14?1, wRit ffiwzr t
cgell MEW 91\TI 1:11 64 ter fe). A aft I
(2) Adarl wFTIEr-It/u-Errarai, co41m: TA-RrErfa/
31uTe A TE67## 4,91 uur u-u-A 31--lqftult 4 a/Pd. TITITR)*itt 312laTiff
ch if I
(3) telliqr4/31ei iM Tre f&Rfm 4 •PfTeR crra
wrEnt/uErraraT 37E4 K cs4r-Er *lour ti
(4) q_a 14c919q-I Ter si4 SIR:MT W:f # 1,411
414, &Kra ‘941$1). 9114, si4 t.ift ‘3o1wr Th5 crt
w,-ggruruyucritzraT iN T9 s!6-11 2cr 4 9. tr Vit
waRruit/aitzraT m11 ThwrzT 34-14-4-9 t dcfarr At*\31Z.viRgyr
si fflit§rd. 31-RTF ;tit 43e1II914/3mura1 arre-cir izreffrse
f4-9-Ew t 37/9-r i-r9ricr 614 W TO 31-Erm 116 1**4 9/6'
iisor t:
zrt ifs i utrarriT 314t6 9/1491& ti4 t EL4 wit
TaTI4EA/3trit2re Tj9 at wr 3T6TR R-4-19 ftzrr arr
(5) At tTefflTit/341?-46-T 1)\LII 90.-1 3TT*R6 faYrasiicic-I t
w:a-grEreuyameT wrr 61911
17-0) 43ci4Ia ffizir4vr wit ffiwrzr EL4 t
sa-grErft/ante gkr A aft:
zru ftcrierEfir 3TEr4 tititiet t Erre .-1141arr
tim 4 1 ri
cgelq14 qiz arlti Tri ticc“ 44 6)4 us, A itt 116a ER war cO4ni
crfa IletIlagrf VITep cfr?-k TIT 31W:19-# W# tt
ujjtj, i1 arr-uszrt •69$11 ung, ti4 tiv-su t ffired. \3cir-rr
toy 9-9-r 2cf writ( ffiwrzr, ockfkri wRoft
tsr 4.tifZgu crwth Ett 9),(14 311tZT #2-1-116ThIEZ Piiot 'f -ftrff arr-a-vr
gkr 31491 IT6 10)17n WI ch$ \Lichen *
1-N•cl Tf* *i-r uErErrt t 311k 4,14 si4sg1 t EL4 4:044 Wr
31-9-u-r4iN 314TF ugyr ftzrr wRiTir
(L) ,1,0144 invreiLr wr ;Ppt sizigicis aft twitrt 31feri51t 1i1
3Nij RY4641(19 itzur wait A altarcrr f4ujcrir 31)7
9 6 chi 99 wr 3Itz1ei 6Thr Tau 3110-Puzr9 Wall 6-911(6 6916 9-4
31gre-A, fafkzit. t 30r9- .1t.4 Tr.4 sielyRtic in 3f-44 teT9
ffiwRil 9-2T1ir,;ei RPtuqi tsi-Trt
(5) tiOTItRit/3P:46T *i1? terat-GvuEritzraT itt 341tIfte1t
teivRRvonvieur 3Tareru-r
(6) qk 43ep-ar itttzr 4 lit-01 TrP# 4 gi'd q) Cil cNri
aTr-474 ffit 31f4r4a9 gkr zrr 314k 'WA 3T-4:1 MI co
Th"f i1iiMgcti *1 6)- 6* 1; \L)). chIticila V(' +ROW t ittf 311414TW.
UZIT c1cc-R-91c1 &EA spiurgt itt ftEr18t aitrwrt T varwrt im.411fUly
tirr, iiftAti-Rtrr 147,4 4 cti-r R-4 A aver 7-13w Turral wr
77-1 V* qR wq-r4Td. arfgrAt ZIT Milch01 trl 716 # -64
wart testrIZ-r gkr ug itt sr41 wf74t 919err altzrei 45't ifi1F&
fSqr JlI1II rtRP -44 atruTr tirri
37Tralhi
191_RPH_Dala.4 Vidhaika Foie (Adhiniyath_2019)

35W ‘13? 3W1 ‘1 in 1 513, 6 31’ W, 2019
1H1)mW/Wafifigfifimfizfim$a§fififi
W/mammaaéafimfimafimfil
(2)W$WfifiWfi/WHHWW/
mamwmfiwmfiqfiafififimmzafiawm
WI
(3)amfiqfi/awaafiwmafirmawfimmmqfi
Wh/Wamfifim—WE‘WE‘I
(4)ufifififiwumfiafiqfifimfimmwfiamw
fih,fiianammsfifimm$wmfiufiwafigfi»
WW/wawwmfiwfiamzfififififisfifi}
W/mawflfimzswmfififififiamfimfi
WaWWWfiW/Wfifimfimfifie
Wfimmwfifififimwmfi$mafig
WE}:
mugffiisfiWREasfiwmfimaEqfiufi'
W/wwaafiwfimmuafiWWl
(5)ufiafirW/mafimfififimfiaafimfififisafimma§
W/amafims‘l‘nl
17—(1)WWWWW$QSEWV§.
mafi/mamafifirfifi:
magf$afiqfimmaafim$qfimgfifigfifiég
WWI
(2)agfiqfiwmafiafismfi$mmwafiafiangmsfi
a—cfixrhmuzas‘mzwmt - '
(3)3fifisfiw,wfiafinfifimmammmfiafivw
WWWWWWW$WWWWETQEW
WWWWEBQHfiHfiHTWWfifiWW
fimmamamfiwfiwmamm,
mmwafisfifififimw?
mw1fiiwm$mmmma§gfiafiwfimfi
WWWWWWI »
(QWWWWHVWWWWMW
WWWMHMWWMWWWW,
wwwmzfimfimfivfinfimmfiwmvm
WWWW$WH§TWWL '
. (5) W/SWH em ufif W/ma 3% Wm ff
mmzfifimmafimmml
(mafiafiufirzfivmfififififiwffwmm
WéfiWMwafiJfiwmmmsfififiWmmfi.
fimm‘fififififimwwfimfiwm
wmmmfiafificfiéfiafimmwfimfififimfiwfiw
W,mwwwfimfififimfiwmfifiwmmi
mm%afiw®ammmafimfim
‘mafiwfimafiafimamefifiWWmaafifififiE'
WWWWWWWWI
19l_RPH_Dala_4 Vidhaika F016 (Adhiniyalil_20]9)
1 /4icci S1t3T 3131TURTIT quid, 6 31713?1, 2019 13
(7) tCILlRI 1t 114r1z11 m sizThi an-4 451 t1111C4 c1) '1(
\Lir -es arRrfkzre attq e-ctitff 61-11a Trzl l4RIjWjt arterawl aM fI1wif gl'41
‘111cad 14)LI1 v1111
18-0) -siMse1t4I?l St fkziWr ci2,evtia gle ter ,rt wer w0711 aitq vit `trig d
ifacH4): WE ;ROI- coni 3Mte cizmI451 4,4i4.1 (Ant .)er ffis
ii1fli4T gkr iici fakir 1 /4414 aN art/In-a-a 3.1.17 fii4f \144R)cr Rpctr
7Tz1 I
WTETTRT (1) t 3Taff fkgWf 1.0cge11-114 3.1MT4 4 31144
cvcic4i it arrd-Rwr we-at in ffi-4-6 ct) 411
m14(11-1R'lt 347 OW 3PU'Ir iM \AK ft.ff-graftff
W w-datt t Moe co,t4 sep-A St ,e6tcto1 c0 4111
liractrigia 3-T41" EMT% Thl TESTI. 311Wf c011t 1 /43411 MKlult
mTh-R1 gm arw_trftu fr wrzr
19-(1) seref*cr artok trcer, ecir stff atlq fer St l-a.)tit
aer ft faa 14741 1 /44101 •
cgettacf fdzc111ctiet4 a aM e 3rfir-a-S arftrefitu
ct) a vac( 614111
settAct Rxcactiettr it arfk-adt 3Mt11411-4 4n StTr4ff
3aReecj icrtt<icil 6)4111 Wgin1 fgazr, opitacis, RctiqRcr‘ 3117 wavr
,t-ARt eau f4kcActleitt artztrcra 4 f4gMe turrw -c14-1 •LINR 41 litff
TrIt4 61,ir attv tp-tic-r TL-49-r atftral Trgei tu4 t wur
61,ir \1•4 ticeic16K 3TrazIT eri 1-P1;44 31t4Ite aM
fditptI feee cri4qRci4 zrr ',MLA UIRT tr7 311*Fff 3TR1
cpck'i 451 11'1 f)r$414-1 ctit .3.4 we 3TRI171 it 3TIVR rIR M t4 451 BT
-tI1i1I
20.-cr- rw TrwwRzat a ffirr trrd 31 a q-rtift stfi7 iwttft
114t-iei• cAiir atl-q aTM't 451 tit4144 c0+11 1 /431,Hr it •fau D)eir
1 /44141
21-(1) faccf 3TREWt St. P1ti,tet •€11Z-r 3kStwrkTir
vi14cictI ThI uctlit c0 4 ir aM wr eteqrt (Ow ‘31.,11 R 'Mite ital.
viitt 1
(2) itm -arlbagt qck-r ‘.-Akt 41 tlarf i1lt4 6)4111
22-101-71 chet1M TiTh-Tz/TUfal; '01W .A4•Ach atti. ts4 cgc1ITiPeRD
Trro -cavil-44mo ar-4:r SrRztt ?I-ft ifkizrt 'Mil Th-nal
,A•tit fau uliqi
23_fac.neud4* -P4-11. R.Aci Itifterr
vrr-et MM-R;
(11141-04q;
f4tr IS;
f*
f. cilvicr GM;
. (6) ticolo cfhg,
(7) 3TU1ZF
.(8) titre eftrea
(9) ITt&91 I-A14; 3117
(H) 4t 31:1 witr-t-wr, ffl RPi4t wefhaiAid4 W
%,.(trtui Qfdcr f4)?)- ‘414
92.$141
toit4V.46
aTR4 antt-rt
ci1awe 1t
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

game;
WM
WEE}
HEMP:
wm
(6|0Z_l"€l‘!“!'{PV) 1°le ”HWHPEA v ”led—Hdlrlél
. Immwmmm
gwmwm‘WMgQW)
.' W’Wfiflflé—h (6)
' WIRE—I16).
ELEM (L)
'g‘ikERJ—‘Bki (9)'
NEW (9)
’WP—fl (V)
’hhghlfia; (E)
5W (z)
1&2}ng (I)
awm—mmamwszmmm-Sz.
_ Immmsgwmafi
wmwmwwfiwwwmaemmuw.
MnfiwwmwkmmgamMMiZ A
Iwwwmwngmz) I
‘ tall-Q
ww%mwwammwwwww
mawmwawmmfigwwmm-w
' A Ital-£1
mmwmmm1$m¥e®wmmmmm
mawwwawmwfiwwmmmm ‘
Ime-h
magammgmfiwfiwmmwmw
mmmm—mmwfimwmmmm
‘wmm‘mghanuammwgzmwww
mwaatmahaszmmmwhsmfltmmanwwm
wmwmmfiamwwgzwwmw
wwwg'wm‘mwalwwfiaw
Magehaummmww¢wwmw®
. Iw—gng—Mn
WléEthmeMMhfiawfi-BQM
- - Immaaagfiemah
wwwfiwwwm'W'wwme-m
‘ Immwmfim
Wgwwmwmwrwwwm -
I . IMMEWkIMEWiMJEP—‘Mfi
ww—ha'mwmwmwmwwwww
a Iwmwawwgw
mghfi$wwmfiwwwomm
- mus
gwmmfiwwowwmfilmeMEl
WWgEEWMMgm—aawfiggawufll
.- - Imamewahfi
mmmwwwwwwmmsams
wmmwwwmwwmmm
El
smz'ms'aaumummmm
14 Tra7T 3TRI1URIIT , 6 3.1W1, 2019
911 Th-M-112
mi4 14R94 . .
24-(1) •Ylitn ffiTT4 T 4101. atiR. 31-4T411 i C0i4Cbie 1ti1 51411, Mitt'
faro fSZIT ksII4
4eilia4R1/3ThlfeT ffizrg 19iT. sipti) MMTLT .415t .4R
cAflr ath writt Malt arfifT tuT cogt atift :
Er? zit fl15s9TtErf4/wraT, 131-r a TITS, sTRit ffiazr t ctet
TraTzil arRIff -) taut 3T-434. farff ,o)Lr twrraiftd- wriku trq
Thm-Rr ftr trTj arrthhd- qv( •tict)or t
*,(1. 311tm7F1 31:14-#-* T 3Taft9, TT* MT1-4 fki11tiicia That
ffiazr t),-r ij ct)id m-3Tfr eru wI Lim qi-lifa-icr - 11)141 at17
312Ifff
RNDttima a Cog 4t1?izil 34'17 coitico911l \LP-H4—W90 tH
Trtur cm-ir akfcineticla tt si4414, jgrq afrq f4awr
\3414 RiaNT,
Vci T°T arR- Rita attq a Agra* 341q *Urrail
tt a-grr 1STq ctrmi att- ticoe44 €M•11 U21-1 31V9T
ird 0144144c -11 -cr-g&Ttiir ;
(Tr) WO* tg 414 Tr4 jf-Rit ijpç 14 wre rffTrit k9T;
(Er) awr fro .14) vii&TT Thegic-r em-irt
25-(1) T14 14ffi4 faYciratile14 TT Apr 4,141-11(14) ffiTRE 6‘14111
4,144444 St ta-- 'it irovr arrzn-P- a aft 'ti1 f$ re0
zif kr114 1
fac11411cHT T wwai, 3j-4U 3ft f4uj WaTT WiTTer 3171,
sttlyRe44 M1ci.0,1, faEtiegr St p-Lifeti 3I1 ffitrzh a Th41c1
wrftrff <t) ,11- 1
(a) T 3tgrizrir wra-411 wrzfrff cp144.444 .P1:11R.gcf
Incleit aM T4T1 04) :—
(t) fVci14wttr St ‘914( ccr at)7 fAtret a a ah q4Dcr
crrmr;
(rn) Thcrfactiviet St aM 1an4 Agit war ww t1144 cd
arf4a- cm•-ir ;
(aro Lipf-;e4,4 kr4 att•irre-irt qthrir, thñWm cmil 3T2TPT \34
qact ctroir;
(wR) fdf; Ycl VIela ttiNuT
Trt 1t41 ffitit St Sraiff cM11;
(144 faVcatlleiti 61vId 39-111ftff c(P(.11;
(13:) 11R1e4.4 3114(hist T arTerR 91,11 ct14t, 3TRTITT-11,
ffidff vi -spot, tiq<p ati? arR:r InRctlidcr) 34Rem ;
19I_RPH_bata 4 Vidhaika Folder (Adhiniyam_2019)

(610Z_W!“5‘1PV)J°FIO:I wuwpm :1 “liq—thflél
5MWWHWM'MMHFH
'W'Mfimmaaufimmwm
fwaamaamaammm(m
. .fmwmwmgmmh
mzhmw$mawmm$wmm
- 5mm
{EEWMWMLQWMWMQ
"" 5% Eggs:
@wmwmmawwmw
- fm
.mwwwmwwwwm
. —rL4£taP—Muemm
ngkwmhmmaemaawwrfim
‘ Iwawmue
W¢WWW€EWwbfifiwa
'mwmmwhuem‘wm$mwm(€)
Imam
WQmwwwmaamwmw
Iwmgmmmm.mwmmuksz
Immanamwawua'wm (a)
fmzwamwmmwwfiém (n)
A fwmwfiww
<mmmewmmzhummga
mmwwwwwmmwmm (El)!
fimwmfiwwmmzuemmw
hum—mgmmwengfighnmmg (Q)
‘ _ aggrate'ygmie‘
wwwmmmwmnmaewmm
@WMW'W$M$WM(€) _
Iguanaaeawmgmggemmm
mmmmmmgmammmmMMsz
figamwwm‘wmmfim/Wseam
'mwmmwmwmmwwm
wugwwwggmmmwm/wflam
A Imp—mega
mg'uxgmgmpmamwfiugmwuwz
6L03'W9'Ehmflfimlfighfl-‘AE
3c-c1 Trat/T 3TITMR7 09-1( 6 31th?f, 2019 15
(41c-r) faxciRwew W tcF. 31-14sR4h, 3TarrcrS 30
cwituNI fkzi-or orfrii u.tarr uffer Acir W w-rdah \rq: yrdl
ti-R9Trim- 4*11 ;
(31-ru) tr4eTS 1:1T9t4, trftaTITTIT 3th zrilr ucair aif4-Em
(t) facAtiiew m -114-11k1 6•Z T TkIlTur if 1R1)11 Tr ffitzr
tIkeif;
(wr) Rfwcii W atarrcrff, uipiPicp kr4 avq t4iiiRcrcT
WI MRP14T. 3th 3F-ZITe711 T 31-tith 3T-TTR1F faRzAct uqr scikci
,
(4441X6) faYcliaVIekT Thar f4m a3KIT34, fie4T-1191, i"4 kvf
uqr 31R1 mtna) 4Fr-ol I5T ;r4-74 cm-ir MIT faPzlikr
tt*11;
(cu) I ciIe q q W fsfit E.19, 1i-44 fareAcr Tptre
t f41.1-r4- cmth;
(k)) fazcAthem W wrzil t coigAcr cp W Riç arrastrw
Entiritt \314,4-circ \i4cmur attR- 3T-q4 Mitfa" TFIRN
ch'01;
( 46) RxciRI E1Ie1T S 30 -4 a (from 14get <froir,
\Ia ti1IiZ1c1 cfr.j att ,<s4 cr),1;
(cr -u) arftriWarr, iiR1q4t aitirra-s4 W 3T-1-4R
-Wcildvid Triem 3t3f *14-Itc1 4-19raI Wr 11Pii111cf uP_IT ararrRff
cm•ir;
Pqr44 945 wrTY4 Trita qj4c1 %-trr
71t/17
(6) cg 9)I tic Th-T 3rT2fEi 6 lf, 31-44 ircfttf
Tredff 6)41 31P-Tcg
([r- ) II 'ATM giir114-1 td dt\LIC*4;
(sr) Nur& gm rI11-1 td 14CotrIcr ftrur 7rRlt;
(A-0 •<1u4 \itmtr wr 7-w 3d41iTtr, I 341-4u Trit4, \Jay 41
wth-r On- 41-c wr 9 A-,
(r.v) ') met 3T-41:4 W r am0 ticartfri
zo wooZbT \rw 31-m7130 yr) TT 31-m14;
(qt) ,<I\rer \-Ncr)K gra 3T-1-4'rlta f$--4 AN) ma- W lrier
Trg
3rm-0 S *ft adt19 F ftrail Tr-44t, f -frW
forktigio wgirra. ftrafr thtWI W cikr writ cr) ,ir;
(u) sei- *Aci 1T-49 *14\1-4 3:11t4 6)41r;
(1-110) Rcri 3TRiwrd Th-1 c01411RuS S cm cli #FT
tie
will arar wg *ra9 arRrwff A4ir \i wr
61,tr;
(5) 411 LI tic Th-r
•
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

(“oz—mmumpv) 199m mule-mm v wa‘de’laI
swgggg
aggghga‘gguugwawgmmmgm
hwmgwaMwMMM)
MMMMMM
fM'MufiwwhumemwMMM
WM'MMMMtzwwaa
M$MWWMMWMWM@&
imamwmmwmmgmg
hMmM$MM$MJ§2§EMM
‘ ‘ ahflwgwwM -
< MM'MWU‘A'WflEMMkw
mew—lmuaawhmwmw
waMMMMM
~huateuu£M
@MEREQLMLBWBMJQWMQ)
IM‘
MMMMMMMMMG}
5m
WWEWQWMMWkEW
M$MWMHMMM<M)
fwafiwmww
'MREMM’MEQAkEWJéEWQELE)
\ ELEM-1
Mikaifikflzwléémsiwfiw)
TMMMMM
MM M'mM$M(M)
' _ ‘ 5M
wwmammmwwmmm
M'M'mM'MMwM(M)
‘LEME’
MMMMMfimeMme
aaafiammeMgaMMm
< 5%
MammwaetiMme '
' ‘ 5M
MMMMMWM'MaEMMM)
film—QM
@MmMsamaMMMMQM
we M 'W 'M $2 Mm ma)
Sl A SLOZ'WBLLWMM
16
\3c-c14 9 xi 3T#W.ITTuT 1\4 , 6 311171, 2019
ccr 411-4Rr
toia 44,
'eat *ark
4914 ar/T
x9 vici
3T1 SITRIWTOT
WO% Thrt90 Ui
liOttldf faq
ar-4-dr
• t
idx9Rvicio
Wit 149nur
(9mr9 mat
014911-891mr
3119%199r 9
5 .1
49 44 td-M4V1 iuiqfr1 10: pj 161: 6)411
c9itiriRtic a WA uzt i faPtua, taM ugfard TRTzil
ug-trd ii Rt,Alq4 :
irg f$ 1*-4-11 941114 M 614i6N 6.1 a ffiTit 4 salt 3,1-409
cHmi cwrrq 3rf44rth 61,a;
26-(1) raw iitiqfPUiId4 ThT l4t_4 icr) f4M171 64t 3t17
I( 991, 3Tarrte 99T1 qPi9I M 3TC411' 3TE119 460' q '1V9kviiciel Me1
/*RFT AtrdtriS tumea 114amurm afr \itKor whir m-#111
(2) qui eic I5J io-f 34TM WI-M474 tT 1:1-41-a 117 371-M1 ikii
3ft7 cqt-41 tO \ila Thfotav1 \TIN'
27-0) 'Rd 4-14?f, f4411:1 4E47l. met t4111TW M fç
R41J 'SWF MM171 MMTZT 6111
(2) Rai •614R WI siorr, 34Ta i1hi4i 3fr ctivel $ 491 'eM
fro 14)ii viRr 1
28-0) 1q1‘31-1 914 facOviet4 451 it4.4 Th4)‘94 ffiMPT 6 4111 9
71U 71r4ItTd 4)491 ft 319-44-991 347 t&ftzi 961i4of vorr-A, 1hclflE1te14
ar-Tam 311rq14 ZIT 3194 f1;41141c17 fflazif M ;04E91 *
(2) Peilvicr w14451 ;Tuff, JS 7r-4-R:et MI Wag% 31)7 3-4Ta eit
3117 cr-1 t-41 ultif 1cM ftr69 lagif vIle-f
29-trcoi4 MR/Re lizr Timft, riteiT *AR 31)7 Rcntrit-14 M 3TR:i
TITRM7E11, jf* 1-11-4Pik 9i4f faxcliavide4 1111 ,94ur 1411do 14)4 v114, 051
t1a-4Si41 6113. ctzcel S ‘,1,a faro th5-4 Aid I
30-44 ere fax9fatilei4 S f4-411 191(94u1 TIT ffl-M171 051 4-14*4
6)4 tr 314 it jiiIiI, iR ag :-
tm aRReT it 31'1 fe711 TRITE •44igicv.1 gr(r yeir
ip-zrr Tim t/*r fldt
3f99.-4ef ei
(3)9ed-M 31EITM1 ai.cidti Vh41 311:17TET M 4 -tiff cs6soi1 Trzrr
s-1/4d1
it
It-711 SeiT M 44-cricirr #1 31-rd 34M7uT WI
cuiclr aik 3T2T-ar wfi-4 f&RT 61, \i1cr>1 #949 04') S 17 Trr- ff fth-zir rtir
M/Mcf 1141 ?El
c-irf ?TT 3T:f 1IT1it(4d' L1ftaretT111M fir4P4 fclkk1Ic14
ft711 TT 451 icjcb iii
1. zufaciiew tt f4R, 3r514 cufasvicr. fq \itiqncr
<fril/m-Rt
it
31-f'acifasme14 g11IM77 TIT f4MT11 451 c.9)4 f1Iki4, cm TIT
,qi4qi1 3-fr4 crq favf 61.1 zi sawit 4id-r c614 It 6)4 cm ft
eatr4sr
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

l6
361? He? W133, 6 W, 2019
mam
WW1?!
Win?
W313.
mama,
mm,
afimmsfiv-
Mama?
WWW
WWafi
Wfim
(naflfiqfiaqfifiaifiafimnfiwzmwfifiwfifififil
()mqfiqqafifammfififim,wfiaififiwfiufimwfi
25%;me .
waggfisfinfiwfiwfifiafifiwfifim$w
WWW—61111;
26-(1)fi€nufiwqfifirfamauwugafiafifififimshfism
W, WWW$W$WW$WE€I
WWEBWWWWWWWWWI
whaqfiwammmmfiafiwmfiafivmmfimfi
mmfifimfifififiamml
27—(1)fiafifififififiumafimm$m
Wafimfifififlfimml
(2)fiavfifimm,wafimfifimafivmfifiafifim%
WWWI
28—(1)fimmfiéfiwfiammugafifimfimmlfié
WWWQSWWWWW, 13321133113111
Wmmmfirfiummfimzfimafiwfil
, (2)1fitfim’efiéanm mWfiufimfiafiwmmfiafi
mafififiafifimfififififimml
1me mm Wmvfifisfivfimfiam$m
W,fi%wfifiufimfiwfimm$ufimwmfifififim,w
mmmmwmmfimmml
\
3mfiéwfifi,fiwfiam$fifiifimtfiafiwmfiifimqu
fifimammnfiasz— .
(1) Wmfimfisfivfiflfifimmmfiwmfifi
firmwfir/afinfifil
(”W 33 3121 in
afifiwmammmzfimfiammw
fi/mfig‘n
(QWqfimaEWfififihmfiarfiufiajfifimm
méfifi-awwfimfifimmfimzfimfiafifimw
fi/fimfia‘rl
(sammfifi‘fmmwwfiamzsfifimfiwfimfiv
mefigfia‘n
(6)fiwfimafim,mwmwm.m%$mmm
Ianfir/mfin
31—W$mmmmmvafiéfifim,mm
.mefiafiéfififififimmmfiafiéifiafiHEWéi
Wfifififil
l9l_RPH_DaIa 4 Vidhaika Folds! (Adhiniyarn‘2019)
dn-K 11 34-4:11WMT quid, 6 34TriTf, 2016 17
32--%ci1enci4 cm 3IP-It -fttTTIi %it tiqttf tef n 34TM faith
c-€411-4 za• \31 re-R1 \TO- W opof 3I2T6T nTIU, ft* 6
•- ffigtf zu
FRT o11.11
'WO tC itzu iflJTzzr, TT trited7 f i\3ii4 W cow( gd ft-#1- ftrofr
zRzrera \flf wed?' 3P-T6T f4WITI q'r iitto ft-r4u zrr
fWzrr :
Litq Zig VIcla f tMt i I c'a 3P-Tqf Thwrzr •i- T t
T11 14 co14 &gm far 614 trz ffis-ovr zrr rui-
A14td arItT, miltror 312T6T
Mwrzi iI5T ticter ccicrr 34-405r ar-d-Rr oco ,a4 i1 itift TeAT9 iTT
ffizrr zrr rtinf*tc ?war zrza
33-114eilci4 TIT 3TMif51t 3TRftTs,
1iRfl iti1, 31E/71-W '11
W41 3T-1-€4 dPIR14I zrr 3tTTrf4-ft Wf
416-f, ikta-frecTi t
Trig, ‘3).91 it SI tif*zil- gNr ViR r -14)g vn4 cua ql)RtdiIIL4l tg
311-4Prt t, Th-T Tr-t-t 1 41- tAra Zff3q(I1IThTAlcs-r will .34 edur
q 6i4 tir f sTrf4-1 zrr 3M tAkr wr co,o)- iiRici,i 1 zu aaret
gN1 -R1 -cf4 f4)411 vilLI I
34-(1W1 3T11fk411 t 349- QTrftM 3P-it Th9 cf tnefvi. e MTR
it chi414Rtfq gNI 4-64 wr-441-
to(cok ‘iricor
34-1-41--4-9_ \AA k wr 1))cir wthr
twopr fbcifdvicizr gkrwtccl e Et" APT
tftf4wR
w-1-41 30 Tire wRet 41u 4t
-di ar-fhlta 051-411 i1 ,<1
'MOH ‘itn cfcf rR9cf tifief lird7 fl41I-4T -4 VITI arizrr- arfitro
wedi t aTero-r Rxcridtheicr tzna' 4-41 w-
rdt t .5-fr vw-R
e &ft tiRNfliciell ar-j-itfo w-r41
31Ii1fTTFI t *Tett t altitff ,(6a- -4
r4t if coli f qa Td%RT t/14)cir
t 312S-
M facIRVIcig mActro4 \Atir m5 timo-tiiitr IR act -Wm'
wrzr, 051 iiorr ST4t i I tttir 3fr'? crzczr;
(w) \ico-r Wcp•oi W Trcizzil wa
r f4rr 30 \a-icot zrq
-49-r .<6•11 dctcl i I t''i met RWril m-r WZT
'(1-4-i4- met far4145T WT viva 30 -39 wRrwR-0-4
Ted 3TR1 Witcl 9I9et ffilZ wcreT q,c4r ‘311-ir alm-sziw
;
(w) fcAvicic.r 3TRIWIRTli it fke4ff, ifarpli 30 cricci uffmer
zrft-d-Rizrt ;
facavicicr altz[Fre atfiz aTR:r tazftrw ut
ur
co -.II c.Ait f4Tif4TE atiT *-4 *FRITTI;
() Zif aE 4 wrzto. apw-
cre a& 3T-T taTfert ;T
1iu'ikt 041-caciq itt, ii x€tciti i.iPthutir iJST witm )6 f co
:<4
fU*4tt araRr W f4-ziftr;
(14) t4ziiR4t e Air 1i9-4 Acn4qccoo g-fifturq, tizr aft
4Itzr Tht, ,4)cif cf ait sivitilictict)
t;
I 91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWW,6W,2019 . '17
___—____________d____———
sz—Wfimm$fififiq®mawfima§mwafifi, WW
m—fim.afimfifi$wawma.fimfia€figfim WWW"
umfiawwfifiawfimmvfififiwafifigfiammqfifiw
WSW: '
WW%W$WMHWW$W$
mfiafiémfififififiwfigfimmfifiwfifi,fimm
Wammmmmfimwmmwwas
figfimamfififimwm ‘ '-
33—W$mfimmafimfi,qfifiafi,m
whfiufiifiWWvfiWmmafifimm,®fiém—fimfiafi
m,fiwffiififiafififimfimfifimwfimfifififiam%§
Wammzflmmmmmmwwmm
afisfifiwfiimfimwmmmaflfiafimmm
344nwatfizfiwzfimfiwmfifimmfiafiwfiamfiafium
qfifimmfim‘ WW gm m finfifi at}? W W W m
.qu‘lzfififiafiégmgfifimfirfiml
(amfiwfimHmmfifiafimgqufiWwfiafl
WWWW$WQWW$WWWIW§W
Wmmfiafiw$mmfimmafimfifi
afimz‘mfimfimafimfififimififiwmfi
afirrmqfifianmfifiafififimml
(3)wmfiw$m$mfiagqqfifiwmfifififimfi
wm‘wmmmmmé/mwmmm-
(Emmanzfimfimfimfifiwféiw—mwnfififim
m,mnafiafiafivrfififiafiva§u; .
«mammwvfifimvfiafifigfifiafivmwm
meafiqfiwfi$mafifimifirwl
m,mvfifififiafiimwmafivmmfiwfifi
mew,fifl$mmfimmww
Wfififéfiwfizfifimfigfifi;
' (mmfiamaaTfiwwwgmmmmmm
www.mfirfifimwfilafifififafivmwmfi
W22;
l9l_RPH_Da|a 4 Vidhaika Folder (Adhiniyam_2019)
18 L1t3T 313i1EI11Er1 , 6 3171-ef, 2019
(g) cr) i)ir tt ve)bictr -s-rrtho- ctn.)- caa
faqifavida 4,4-caRilE zrr iiif itzr Rara-i fkrokui
M -altar; •
(g) R1wdl * f &Rat a' sr crr-Rwriit
F4T-4' co4-rma VI 811 gkr øi4 arm $ Trau
sittr cir<4 Mvitar;
(7) 9r9-4 \iv! wr liqif Rqr v11-11;
(Z) qilt fti cuTrur—tra S Rut Tizr-4't 14
014t1 .
(U) 311r-1tti., Er4-0 a-ch-fil
if0•Ta cht-11; ••
urt$ 9}zr argrftr9 vair;
fakifacacii $ trftfR $ ti Rautt,
34-04134 atiffi- l WITTRI c4, -11. 3T17 \.3•14;) *Kid <Nil;
facifazacii varwrftzil zrr &Raft-al 4 fed - 114-d4
p) zit cfr zarRzr9 t arj--taz faro
..aiurr-kw ik
sTrwr
(4) 411 14 tic li11wei4 S .r$7111 1447.01 Thaf Y11.4vitil ZIT WS
lcii 4* aarfd--d crn4 cueir cr)) 14PPi99 ffi 61-114 411 S 9t th94 TWIN
zrr Ry-tm CRP tt wRiwzur u3?-r1ad- ffifk-d WI -
wzr cicto 451 3t4TR 9 fair uito STfr Raz and- a -at WI- TzT
cni4 tiRig un-r Rarz fir 7-r4-zrr
35 31Riftli StIRE*144 31TCett 314.19. •<6
4)1 .1•14 -P4-- 1iRgd- -14,t11- Raw $
utra-ea 31altq
f4i1èiel4 bi-)tt a Ow STfl wur \51cnt thflicorr;
qzifavicia zit
tucliasf Rttrffi -R>ir
(9) 914-m S 1ST a trram;
(Er) wTritrzti, 2Leilerr, wifiliT—rfq UeTT *iPit I ql W4Tff cM-I(
30 394 atter METI-ftu cfroir yam falel kyir.)
vit4 $ TriRcia ffist uii4 it(4 1/43La ;
(z) fazgratacia 4 31U1z49 Lug so wan attaTrail u
dqIRldt itt4*9raff S wara-r—Wr ATTRi wr REtzur;
(w) arRas-rWthert, 1fl,ICr14i. favyautr, trawl S
144irr cm4 s-r4;
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

(sloz'wfiwmpv) Rpm mummm v “PG—Hal—lél
32222222221222
wwm'm'mm'wmwm)
fmwwafimfiemh—mwm'mw
22222222222221‘22222‘2222222222122122w2)‘
fmmwmymmRMM
mmwwwmwwmmwww
MMWW2m22h—w‘wmm2w
fwflmhhu‘emmmn)
‘fmmsgggmm‘gm
., M2mh-Mwmm'mmwg2mwmm)
' fwwktfifimemmmgmmmw
‘ -2;22'2222222@122b2m-
22222222222222222221222222212222122222222 2222
Whfiwm2w2wwWAE—SE 22222222
Immmmhwnmm
mmmwmmfiwmmhmawmmg
2222;222222222122222222212222222222222222
{22222222222222222222222222212222222222222
mmwwmww2mm2wm(
Irma
mwmém$waswmwm® _
. {419me
= 2W2222me2mmmmm)
-‘L2r22212222222uu22212mwwmm22
ERWM'MW$W$W(2)
‘122221222212222222LEI2(2)
.mmaga
222222222222222222222222222w2 ‘
' mama
WmmwwwmmwQ) ‘
immmwmflmas)
fwwzmw
22222222222222222222222222222
.222222122212212212222222221222222)
22221222
222222222222222222222222222)
Mmmwwmgamwmwmmm
GLOZ'WQ'MWMM
z 31311ETRui , 6 3111i?1, 2019 19
(g) Otarrat wr 31-71-ff urfte9 -ffi-wrzh, 31N-
3471t9WfWr 9-4-rat3M ffiziffivrfl 3M m-4-0:14tt;
(7) facifasnekf M iii M ffi-a-re met sicl;
(w) untaft M ffi-art, afgrftr9 aM 3TEZITEF \3114
mtr fazla aramr#, coli ft atly fo-c facifavierel W arwrfa
favltr 316TIZR ftr6d cM-11;
(51) t4niRIf; f79M Rw iRffiwit UnT ftm Trzrr
ftr9 s4tuftth met ffisfavr 3M 9-ftMITErr;
(z) 31u1R19 3itz1zr9 fl, 3T -dtttzr 31E2RF, faftrtz
faittz 9-919s#7-rail iwrcrw;
(a) 3TR:r favafavicitil atIR- iiActkun't ft-frM 3T-4Tra allcH-11
zrr W TrozOr Treer-dr met W;
(z) 144. it 3T- r ffimrzr itt Thafasileiti W -term
TTR W 1i arrarm tp*ir \AK 451Ti319, utmet tkciir 3M it!
co.N;
(a) 91tar4*, auttrrmI, 3T-- ter4* aMtipoilzicoi Tra-r9 fa)
cll 11-1ffilltM;
(up 3TalTcr4 atIR- 3T-1 term sii-ciiRlq met tar met
ffi-a-,c19 91:3ft9t gkr Mita- tt
36-(1)fauf1vici4 4t qrfiim 1:31#8 cold tiRtiq ffi-ku sitft9 Aziw qiNt
WI aft P.Tr \34 fa-Arma atir 141ta fakir uila, vrrift ffiwrzr rep
lbir 4r#Trr 3M lI ffim-Rr an4t gag) tam It REIV trz famN
co 4ir ;
u1tMM-F4ai1 t ft11.1.8tg 311:14i fèuiPiii cpj4 ITRIEK 331-$
famR-Rf 917ffl a)411
37-(1)faZcIlithel4 451 0T1it$ *Ulf 3N wier-tm, std urftwq W ffit411
$ 31th9 AZIR fa)4 771-4 afN e),Nr-traqtaTr, qjçf -c11&4 )1\1•-d
&TT-a arg wri v-r-m wEt # t m-9 ym w7, 31*W 1:1 -g. Trru
31-Vra. m7R11 7-MI I
(2) atql-tritir 13#18 wita w14m/c)(gr3ll met ct4 9ft9-4-
traull W trzr vult ffim-rzr aftR- aiciA414/31tzrat 4--1 ;Fp tl wr#TftI •
ctrALIR/3It2rei w1 clifaco at11311 fa)a- Irt (14 e-TTIT, Wrift
frt-RI 3117 anzf #ThEr-q- wrer4 ativ tifa 4)14 q
tid ti (44 9k1 mtaaTur ffi5t it4 $ Warn ‘14 arrift-Or/sitzreT Wr v-47
fakir 71t9r azu flIcivAct) OW faeir 7rawr
38-(1) faVel1411(14 oir SOr$ ct4t4l wr 3TRiftarr 3M a-cc119 c1,11
Tit LIR1z144 Wiet ffiziwr fakir 7r#9r/coi# tj evik.ir
wr#Tir
skuiReif Th`t
r lhf
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

6]
931%
gamma
'mamm
m’m
(sloz'umfiwmpv) “PM wwpm v ”lea—delél
Imam
mthflz/flzmmmmmv$®m$mah
wwwwfiwwmmum
Imm&wwmmml
wwwm/W&M$mmwwmmm
zh'Lawan'unaquwawkm-aaanwmwm
w‘mamwmhhuemwmam/Wa)
. ImwmwfimR/mewwmaewfi
:42 Ahab 91% new Lac ume/eeym 2% gum men-me (a)
. .IWMMJEM
gammwmmwahmnmmwamww
QMwm'mw—mwwmmmwg
maewm‘Eh-hafiwmwmmmum
V Iwmramw
_M¥EMMWW&WWMM@
”my.
Ammamahmwmwmwwmm
amléemsaawmmmfiewmwwmwme
mm¢m$wmmmwwflm
Ikahaawmmghm'yswmw'
wmwmwwsawgmwmw
A fwumauzwa
MMLQMMRWMW'W'W®
_ mi
ywm$mmwmmwmtBMM®
mwwmwwmsaémmmw.
swap—1m mate $2M yak—mm we mam; rate (2)
fmwwmwwm'
"Mm‘WWELEW'MWQY
imamwwfigwmmw
@‘emmmywmmfwmw
imgggjgihgzmhhmemg
Wanmwmmww‘gwan'mmmw
wwmgzmmzuem‘w¢wm(fi)
figmemmgawszmmgm)
fwwwwfiwfiwwwww
wwwwewmwmmammw(m
SLOZ'WQ'MWMIEEE
3111- co
afftrwR
m--4-4rtr
ffitr arlv Tit
xa €41
3TPOW1
311745Pera o0Y
Thrt 41fa
20 3c-c-N• 1I1 3TRTWIRLIT IuI, 6 WIRE, 2019
fcdRE.lIei4 3tWI. fR1Ci 4EIT1I M 9ZJ 'ioT clicli9)‘1
1=4-4R 03cI1IRI faZ ft-tir slNI4Ii, ffi-aTi M
et Rift ft-a A
M Itrd• 31-9WR 1AUIcr,o4 W Erswo; fkrq trR qPx-cyr
3T-ieudt WTI t IfT Wq-,t 3TT-TT7 TR TIT 30TMTrom zET 31Teim 3TRTR
wrd-Ru 1M-4111 <Dila W 3Tizr-,4 fm-di faarq met 35--4-
4 30 \to 1:fq
'1tr qP-94, MT61:11t 9H1 fMiTT MliFTT
39-(1)014 arRro- ZTfc1 f11EJIeuT W fmti aritmit zur tuRrwrt W
-Witt qfx-cizr W f4-w4- arcit qPx-cw mcr wrikr W ft9-rw
(Ti-r 916 met
3T4f4 .MITEd7, ScA914/3TEzie-T m'f MT7 •419)01 t :
zr-g fW mca-ercrIt/3itziaT W gni fdwRI W ?)- *-4 met
wffivr tit, a 3,601 ZTflTTFT it clit f$ WWI ci uitf
fic-r ow/ iltd7 am* S wq +km Qui
(2) -@11 telAir14/3itzrai wi Tana Trzu 4)14 f11
1 xii
artdiT
aci-qvcrWriew auT4 mktriNi met AtitTT ,F114 t
zicif W 3T1r9. •t64 F u)tif iM colei Trforq gir fdf)nrcr fMir \ma, \
z1T chetnulchi41- 91\31-041 zIT giftlsti fkM MT +Id.-1 (t) ,61 ziT 1T414ir
z4w-91311- <0.11, ulor wr'4 3Trr-1
rwift iItia u iMr mar FMTitf ttk 3Tra,
TF9T,4Cflg ticnor zrr arT 4,h-1Iauf, fav4Eriegr autrP4 it, lt
iR cgcloRcr gro WiiPicf -14)tir Trzrr 4, 31*-4-9, 3:09T, an-kW,
chi 9i , t40e'1 zIT 4tthavf m'r zrr salt met fawillor cr2m itz;zrr
Tuezr W 1 4,16.111Mzu 70-Trr 30 3o4 3TRfara- q94 ilo-16•< r
wEr 3Trezr W jtier ra)a 7[4.-4 .161 .4 ?a ter TEE gR7- f4)
3116-71. 416u1 61a I
M 3Itik 9-114 *1. TARP911, 3It4TOT TIT TWPTI:f
facr cuotr .gkrutt fmtl -rzliii
wit 4341) ThmTzf tf7151J 5 (114 ctra.5 „1 /4,94 * \IT ..PAT-dt
fer fAtr wrRrff m Tftr
(2) .(wzft ftRTRT f'4r MT ugaTT, miftra q-971P4T TLE qfg
riftgd cm4 M f4 frr -rz)Trr 1'M f. cif4rida I arRifizrrr ucrnt ThT
31@Erra9 t uan **r 3TRA-ag, 14RPI4I 74 a/ante( ucr-4-4tt
37T1R 014 Th7 7-6T ti qYc1f1VAlel4 3T2T-41. 11141)u-lch .1M-TET gii tt 3TRifkmi,
'iR1i4i, 31tzfrke zIT WT4EIR eirri4 Trt faIi4f W dgetf I5T 3cTit4-1 <m4 WI
qw \yer ,twok W TrkT fwcfr ?It M fttit omkul msr
ti'1qcf cm met ifax-I ffiftff 6)41
(3) woo itcfr -1)R 34 6.1 ic.1I 31.17 M"3-LrePT faxcrfkiwzr
W 34TO-4-4913U fawr-fr tg 31aTTOT faci14irer4 au-d-tm urtr a TO cj my
*1001,1
19I_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)

§o~|=i..=_€<w 20m 5:2; « 2512x40—
. .mE . .
EEEwfiEEmEEEEEwEfi . .
EEEEngEEEAg
_ . _ .3Eafiwfifiwg
figggggfiflflgflgwégrcfi,
fiEEEfiEmWEEEWfiEEEaaB
.EEEEEEEEEéEKwEE
wEwEaEEQDEEEEMEEE
EEMWEEEEéEEEfiEEg
a; E w E E EE 5 at E..E,_.A~v
_EEE£E ea
Egfigwfiwfigmwfiggfigfificlv EE
EEEEEEEMEEEE gags
£5E.E%E€E%§E%afié fig.
_%E¢E$EE$
Egérgfiaimsfifisfirfifizfirfi
%E%E§E%EE.EaEwaE
EEEfiEaEEEESE~E.
_E_EEEMEEEEEEEEEEE% E p:
fi_muEEwEEEE.EEE5E_E_E @EEE”
EEvEEfiEEEszEfi gEfiE
\ _ _EE»+%E¢.EEEE
EfisggggésEEsg
EEE.EEEE&E%E£%HEE.EEE
Vfiwgfifiefigfigfifisgfié gag.
.. . Eggs
Egfigfis§\gflfia§gfis
Egfifiwwfimggw‘EE
Ewgfigmamfisfifiaéfigawfifiw
fifiEEwEEww§\%&EE
“mgfifim§\a&§.§wa§
5
fiEEEEfigfiflfiflmflBmflBwfiwSlg Eggs
EBB
EEEEwEEEfiEngEg
@firflfigggggégwmafig HE
Vwfifiswfigfififiwfifigvfigfis
vaNKEerPFEk/LEEE , om
k.iccrq Titta 31-f1W-TRTIT We, 6 3.111-i, 2019 21
Ia.-iiei VuIit ettET-43Tftr 4 \Al irt fs ft<cnk
gkr fro 4)7, 4 ffiffiiiiiu 4 aft at131cOvricier 1dEr-e9
(up f4-1*-fl v.41 afr
41t ara t1 eolith 4 faurff lii vii•1/2 S1-119a 413
,<1,1 S 41.4uct) wrr Ad- 4 arm wrrr 14)4 A1-1 /2 919
uvrl Tizr vr4 31PT %if witTrr fs Thief \'-ktlq a 14 ar-vT t Rrir \iocr
ET93-rftrml 3TTUDT 711 TrztriT fsTrr wilt!
44-(1) faxcitawqw .srs twri-zr Th-Rr 3:P_Trierff <0411, I3l fTh-faRgo
ET-43-rft u1fli S uiRi4l Tg-TiTd
(T) *I1itcf i #t fklP1EJIel4 gkr 3-47Trfta 1-4)4 wr
3T-s* ; •
1*413T-421 31/2 iitc-r wityr ET-qu1t-4f;
(Tr) timio gkr 14,4 Trir air4T-4T9; 31'1-3
(ET) it* arr ci r ffi-srt ift ortp-vr fst aTR:r
ffiNI gkr ed-firq f,gra Tfr ffiftr f4)4 Tr* 3:rt arta-cm ;
(2) *11411-0 Mit4 v19f Th-T 31:147T, qYcliatlIcl 3Tra
(2141 1f4 Th f?)- fSTrr arr
45—(1) facrikrierzr IN) MTIff PR 1- e-TTferd. cr) I 4fit
1RsciEmTrftr wTrr 5 7p!rtft, aw_Tfq
• (T) itsre b)iii 31/2 ;red It* 3T-sk t ;
• (u) RviPtriew S 1sr3T* v41q-91* -1g ar- r to): 31 /2 WTI
4 Trzft tifltcr ET-43TNT; •
(Tr) rurlutcr) fThs-gr UTRT fa>4 Tr4 aivr-4T-4;
(Er) fst 3MT wfdfr TIT if4-stzli,t onyier uqcr fSt fa. wq
;O1 tr, gkr Tfr iThAftr& fa,e) TR) 31 /2t aivr-4-m; at13
(U) WTT4t 113/4- R3 t 9TTE witcr armi
(2) 1't'T31 /2 far 4 \II-HT—ell-14 IN WIT 4 /it tT97Tit TT 3t4tTT
T 1ct'r3T*4 fsTrr arr
46-0. 3T1Iftz11 T 310T9. viliefff *141 fat chi4 ITRIEfq T
1141ur aft f)4-mur arart9 Tien Rffcl RI31/2 faffkr 31'1 /27 3T-Otra
aft
47-1YcIDE1R-14, Thw-1 tkchk. 3TQT4T .404 1-Nct)K T .T4TPITfflarff at13
ThTtwurrEfn fst wzi ftsni aTers fkir4 31/2 f4n11 *16140114H arawr
1*-4t4 twieror TrN &FIII
48-‘941ti 114vIrlt tNt4-11. Th-T fa1**44 chiti tiRtr< g
Rr WtT1T 1-N1 zrgItY qxcifatrisier, .,<To-er tr<cw Thwitg far
arEfR arearff aTers fazwicr) 1 -sr4i- TRH Thrcr !set t as •'zj•
aTcr4 t mrtfta cr)4ir 31)3 .iricivAco wq 4 ,<
wilt I
*II'1V4 ft
crio ft
ffitrzri iiarrTur
xci1'I4E1IeU4
toracci
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

Wmmannnsssm,2o19 21
(4)1awrmfi1aafianafirafiafimfimfiimw
fianmsfimfifisafifififiarfisafimafiafisafiamaifiasn
sasfilfiarfim‘fléisnatfil
(5)aiaaafaafiafinfinfifiam%asfiainmafiafin
mafiaarianmaiaafismawfifirfisrmwmwnaimnfifi
wwaszfisrafirmsramfismmmzfiigaafifiraifimsas
Wammsaainnflfirarml
44—(1)fiaafia1aaamsmmfifamfiam,mfifimfirfias mm‘»
marmafisrarfisraiaz—
(35) W {IRE sh fisafi’araa Erin mafia ram an
W‘s“,- V '
(mfisfisrsraiaiaiamsmsanafirai;
(mmmmwmmmmm .
(WWWarfisarfitfirafsfiafirnaaqfifirmm
Wamafifiansidmssfifiamnawfim
(ammrismransfiransnainfasafiamaaiwfianafi
mmgaammamm
45—(1)fisafiaisawfimfifatfiwfismmfimfifi
WWWfiW.HfliT—L— '
-(m)fizfimagfifi,shmafisanrfisfiramsaii%;
w>mmm$m$mm$mmmam
'aéinaiamsannfir;
(mm-(mammamwmmm;
(wramimmfisarfiariaiaismnnaqsfiflfififam
Wanamasfifafifirannwfimmwfin
(s)wrzfifinrmfifiaiamsnfi3rral
(2)1amfi1afiana—anaanmfinthannfaansaain
fisafiamaaifimaimfirarsrmll
4&3ssrfafianaisr2finmfiswfififaaimafiazaism WWW”
aaaanafinfiaanaiarwmnaarfifiséifisfifiafisafinafigfimfi
smiflil
7 47—m,mwmmma§wfimmnmmmm
WWmfimammnWWmm
fififinmzfifiaafinfizfinr
48—W9aitfiniaifivlagfi5sfimanfifnaaaaflaafiaam as”
WWmas%fiwfim,mWa§fifififianmfifaai
marafirsaaarfifiamzfifiamfismamfiaswsamw
mwamafimafiqwmmmam
mm
l9l_RPH_Data 4 Vidhaika Folder 1Adhiniyam_2019)
22
N3ccNI SthI 31-ffTETRui fluiC 6 31#3ff, 2019
49—t12711 ATt4T 614Zh ti1T citil The1. an%
'Vita 41eqicfri sr-rrz19 latic UclIM T1T 31. f 1•!chN
911 194-194 tR 1'4'o f-z`r ,3114, wid cr,44if Iqg 31- 1 RitiPiet)
iit RxciWild4 ti6ui 1hT 'it Inclqmitt tt ward t
AILTE cOiif I q6. it?)- TP) 3TRFei
osu i-kok mi qjffl ctiri fieCT-611 i1414-1110 'ER. 4-#
.jC Ct)0[ tit-4d. 4141111
50-\31411W, tv1 41I 14cv1 TIT it-fit 3TRI liq)uirf ffiff faf)e-Pii,
3ItzlTket ?NT qN4ii gio TRU R11ciqlfff. ;r-rw TfTZT5 4 foraEricia
wiTrzfig Th-1 far wrir9r
5141) T 3a11#71# 3 ff-4q1-9. Aat #3/4 MT faRi4f
jy*ìf 451 31-j#Ta-ff iSraffff cm4 c.cv \istr Mew 91'019,
4 set 3014-R.# 6)411
f41 VI el . ftc#9. 1-66,#0,41 .Atd 1311->11 3TRIA.€1.,
tuiiq at1z 9-41err tif-Aci 9 614 crie1 arROwr, \3ccp( 9-aw .3,74
Mall tiRqs051 99-g-6J 4zr9 ur-91 Wr 31%9 wErrRr \Jay- yew \I-L=4
wr L4Rt4q W ugat 3ir991I 9111i1 141,d,crr<4 oic4 i1ith W
WIT-kg M 31. 30 .14-1 11.ff jcçlAaYI \t“.{ Itair trftER Zm
Vi7 fan4 3tt 1IRq4 \34cr t1 451 3r-I-y1re49 w-41ti =rfa 20 R-1 M
td7 tfffER 31T1)-4-9. tt titoir Rardcitcier w-1 41 t a 1,
39.itiftUm .14t w9611wr9eili
'Jccl' srtw ivti \int IThir 1-1 t14., IYclikficizi
far& crtOwrt 3rarar Sit èfxifatrielit zwzrI349 fwzli 3199r TIT
afird-44 Thsf f414fatt ft-9[w 74 tiflo 9r9z 99-69r cmi4 f. 4 476 ticror
f44)F 614 urz \icrpr 99-ca Ir4 \ittr ftrair 9139-9, wrjr99 4,14,1161 tg
fluer tHcok f4ti18 4.19a 47 W-t—dt ti
(4) ki Ca.( 'Tata 'thief ktvri ft-TT tiRtic T 3#4Th.#.11 \34614
ar@trr cm4 3t1z triarthri ft6TI A-419 <frog iltiftqw <fro1 W w4lw-40 wE
arfte499 W 349 W-Terd faxcAvieigI wr ZFRt wPr kw a 1911wor wt91
qniatd W:1 t-f1 31treff## gRl. 3 31.th
3T-Tfrg# TIRE-4-1. arcrt clif4t faur•ftL98 *Ncr,K mM sTzwd w4711- 1
52-(I)qYcl1klicl1 31.21-41 faY9W.11c14* RA at TIT 3TRIWt1 On
71U Wtaf OM ft W 'DYc1tlic14 AVIRTff arerw Rcri wwrr attz 3rr
TrrTra't zrr i1itviiql arrft t Tread- ‘199-rmg 3f4Mg# mM AR?Sa. (0. atif ft
M;t1 litzPV1 urfr Th-lr mci vilo
(2) zift mkt *Novi. Th-T Z13. ?Ont ft 311.124ZPi, .141 31ta-kta
Trf Uctit9 1.11 a Tit \ievit44 gaff t wg arRe499 W 3m119
qxcifelier9mM 4-4 fk-kw .A14ZIW wat t .1* 9g 311-447a 194 3N
qxcifavicier ffitTfitd 1414 4-d7 t fkka wr 31-19179 co41i1i
414rII4EieW 5T
LIN etti
wcrrtu
‘icci
fORTT
.r1
fit
Suf 6
afferkat mar Tifrr
elea 411014 The
sfaridt
19I_RPH_Data 4 Vidltaika Folder (Adleniyam_2019)

3.24:3...53 52.: 5:35 .. 554..wa
_EE§§fiEfi§wEEEE
ngEEfifiEMEEEwEEEEE
wfiswgfifiemigfimfigfiefiwfigs
E.§.§&%EEEEE%A~V
.. _E%EWEMEE
@gfiéfifigfigfigwagfigsfig
gggggéfigfififimgg
5E5EE$E.§E§EQYNW
_EE§EEEE§€EWFE%E
figfiwéwmgfigfiwggé
EEEEEEE¢EEEEE§fiE§
figfigggrgggggé‘
.E.§E$EKEEEEEE3
. fiEKwEuEfiEE
EE§.EEEEEEE%EEM
Egggggfififiwfiéggfig
QEEEE.EEEEEE@
_§EEE%EE
@Emfisfififipfimfififigfigwég
wraaawgfiwpgmsfifiwfimééfisgmg
fiEEE‘EEmfiEswEwEEfiE
wEaEEEEéemfiwgwwMEng
EEEEEEEEEEEEfiEuE.
.EEE.§%EE%WEWE%E
Eggwfimwfiafigwfiafigfis
_EEWMF
.gauEéEmgawwgwEbmmfificwaflwwsEmsEE
WEEEMUNEEWEVFEEEEKCIW
EEEEEEEEfifi
Erfifiefiwgwgmflflfiwggflfiwé
..EWEEE%WEEEEEEE.EAW
. _E§w§
EE§EEIEERE_EWE#%EEW
Efig€EE€EE_EEE\E
cpwfipflgwgwrggggfiefiflfi
EEgg%_EE.EEmflflEEIEEM
EE.E§§EEEEE.BE§
.Eflflgflgwfi,%fifiufiwfir§fifiwfi$
28 FE» .m BEBE Ewfim
‘3cck Elta 3i1fsT177 ilvid, 6 347-i?1, 2019 23
53—(1) i1 faciNvAlem 3nT4 4 iorr .2TTRO cM4 ciieIT
fa* sr-gin arcr4 Riei 45T 11tc114 cmor t ,<Ivtr iv.cnk i51 ar
. <t) faitff 9srfe-fr aiir
(2) 3ETURT (1) # ffiNEZ *al. Thal Aft. ER 'flutf i-NOK f 1 1Id4
Thineff 14f4 k 3t1 q"4 ccb facilawaLr qif4d 'fart
-r.f apT4 14104-1I ti zo cr)t)- favoratirazi 11
wiltiPco ursTrq sir 1-ar 1* fetu itzrr "1141
5441) 3ifefffili# Mel" WU 53 31419 f- YcIRElle1e-f arlqlPti Th#
4,10,r cm4 sd•-r fax4view -soim•-r* fat &HI zkfa wart f4RTR1
f4R, .919ir4 f4lr 30 ?Oaf ffitr trtt UII41
(2) ea 0,4- 3-ERTRT (1) # flf& f4-Ryfr,i- ctRulazr
• ativ alqINI IRT ur<4 fa?)- =raft ffi Ir4 'WOK gld
ttr ar urg favol&ilatr tp-Likrie41- u2Tr 3rr13S a 14*k-1Ni-if
Trt---dt t
55-(1) mro ‘i-Ncni Tig Wend 6101 t 1* IP11ie14 # *tf
31t11###, NRPW-1), mi,èii zrr 70t9. c4-114 qPepilt iwr \itActu Th—E
\ftreitirr Itirr t ?Tr *tr 3rltif4zrq sizit9 3-4:r* gm 1/4,01 fct Th-a-cir
\3eati-1 sitzrt t ?Tr ETRT 3 S 3111.9. •Siqcc-1 fig11Pcid cN4
Ara7a 1TTIT t TIT ThtlzIst TT 04d ZIT sf4Nlii zIT Tiqi17 -s-t-wtrrr 1=$z1T
\ic-cpr ;thr \ivcr far tre ;rr*rT AT4 tiriAcr
cly<4 .ma t
uprzTRT (1) S aS ffitd MterR faVcatIleief tt 414 -13E48
mta v114 ER, 11 mi4 ivcw 5T ru Trimuff f$ ;NIT itz-zrr
a1Rre4qTr zfr ff-O'R .4414.)- 1-01)w-r1 zrr aTarthil zrr tfrlicl ?Tr
wcro--41 I5T deatm 31T t trr T 3rff4TPT t 35 Ara
Ma. pH. t zfT UM 3 349. li<cki crcilEicgOl faniikd
Ther t f4ferth cOge zir if4ftTitiT zir it4t Tt-trthlT
cm4 45J 3tItc4T 4l \Atli ff1 3Ic1lS TITS!
WIT-171 (2) 31411-9. ulitt fa3/4, tNchl ,
31tiri ki \icrls( 14aYr ,<Ivq4 ntl %LT LIRtK#r thiniPzi icH
149)Pa 1*-41 Zart-11 zrr 3:Aft aitr4zrgr wTOT1
t 3art-2-Tt Mel Ai-cr <m4 fa4, fqzjafr ws-41- 1
WIT-1TT (3) 301# 1#Zri Skf- Th# *tf 3aff#ZFf
*aizih arizr w-4 0T tivi<4 ctr<4 tonr f3TraR 9fth-zrr TrIt-dr, 1908 3ittk
fth-fft mwr, N3itecr: Th,--ARNcr qtioir
,• dincr ifavie/t 0.11, amtg :-
(T) fsift Trret ffi wirr <mir aft7 ucrRP-Tff 04 ATM
cM YrcraT \telchl Eiiirf air;
4ttilauf 44,1(fror aM Wi7 ctr4 31-4rr
cMlf;
0 ell el
13/4E79.
1-0Y010e0(14
ouu
'<kat twoK
faxcifaciiegl 51
wR-frgrrcr9
(TO
tide14 t itt At *TAW Tir 3141 11 Met Tur
ctrelf;
(IT) vrtru tFI ER TITO 1411(1 cr,<-tr; aN
() cr>1 31- 1 91901 1-,4 ?to- if \31141
19I_RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWW,6W, 2019 23
53—(1)Hfimfiwafimmmafimfi‘mm W W
WaEWamfifiwwmmfifiaEWWafimfi W
wwfifififiaaafifivéml ' -
IWWWW%WHWWI . ~
5H1)Wafim53$mefififieafiam$éwfifiafi W$€Nfi
WW$WW$W$WW$Q§TWW WW
.W,Wfifiafivfifimfififiafifirfi1fil ‘
(2)afiwm$fiwww(1)fififififimfifimfiam
$mefivé¢mfifiiafiwmfia§fifiqfififiamwwm
WWE‘I _ '
55—(1)»ufiwmwafiagufififim%fiiffiwfimfwfiw WWW
Wqfifivfiawéfifimfiiefifimfifififififimfimam WWW
Wfimémwafifim$ mafiamamwfifififififiaw
Wfimémmsifimmfififimafifimfifim
fimfiwémfimfimmmgfifimflmwmfifim
wamfiwmmmmmwmfiam
Wa§mfi7¥wmafiméi .
(2)wum(1)$amfifififlfifi%¥1‘wfisafi€rmafifimfimé
WETWW.WWW$IEEW€IW%DW§WW
Wmaqefifimnfiwfifiwfimmmfimfiafiwm
WWW_W§3U§UI§HW$WWWW
Wmafiwgm§mwazfimmmmfiaafi
fiwfiémfimfimmmgfifimfimwmfimwfi
fifififimmfimméfifiwfiia‘smml
(3)m(2)$mwmfimm$m,wm,
-W§mwmmmfimmafimwm,
mafimfifififimmafififisfimfiwzfim$
W$Wafimwfiifim,figafiml ‘
'(4)m(3)$mfigfimmummafiwmfim
$WWWWWWWWWW,1906$W
Wammfifirlzfirfiwfivrliafimfi,fiaflwa§fimfififim
afim‘afifi'flffifiaflfi :—
(flmmafiwmsfivwfiwfifi$mm
mafiwafimmmfim
mfiRfiWafiWmafivwmfiafimm
m,-
(mmmmammammammmafiw
m;
(H)¥N9JWT\’WRIWW;3TN.
(@mefifififiafimfiml
l9l_RPHADa!a 4 Vidhaika Folder (Adhiniyam_2019)
24 SEkVT 31-411T4RuT 1h,IC, 6 37TRTI, 2019
.e1.10K .$1
411TrItiict)
nta
Thc.1 wirer
f4Ereq /
411-4o1 .<q4' 6
CR
a-151%.11 Th't
;ffRvrtt
Arcr 91-8 ui yr-- tkchk wr IS tTnIITA vtitr f$
facrfavicitr *.tr 3TRAtIli t ftti \396144 tT ic-eitirr fir t Uv•IT ciçIPlcd
3itITTrort tiki1 S 31raFITMt, 7FTI- tk4V 1a114td tp-Kr W
*ti 3rRinifF 5 \i'AEMIT alrIcll c"4 fk 3TRV45 mz cN4 t Pai
Rxcifasireitr S 4411 iR facavAiaa W- fbd \pia S Pi Z151
ar-lcrraA cN4 Rtteei•6cir t ti Iv4 'WOW, faVc11411(14 StRk fk-a-zr utpa-
cm,) 14.-s6 f4A 31411 t tw auszvt w_rw 'zrr \3yiet1k1 1 lq
Th-avr Trwer t;
3TRIRT (3) t 3IdTff ffitrOf urITI 3TRItT11 31tIM jiitr 3*Tr9 t
itz#8S ;rrftr -Eft I1 ivtr tP<SP1 5Tzig 311TRITff er ART ft fasfavie-rtr A
*tr arRrfAAA ?Tr nrt amitA srila TP4 zrr ararre-vrl zrr faPerfli
tIft amm Wit uursiTmi atisivr fwzrr t arawr -1zr4ovr 3-qt-TRT (5) t aerA
Ttke Si st 3I1in7TIT 31.419 gls11 1/4TIA ftl:1 TRT ft# fra-zr
\Rvelkirf ftqf 3RT4T viRT 3 t 34-9 3-frt gNF I 4141 cralscgiraft
Niarr ct>4 t SIc1 I TPA t ?Jr facifavierzr ffitzli wr Otid TIT iffeq-eRr
zrr TEITrq i-t-crzOr itar TRIT m. firtf qVcatIleRT StaTrIrt 411,10 zR \11.4)d
\JO-1—r Trzrrffi tv4 *I.1471,1 TaVcIfklle14 \i9vf araRr
faxsfacriew flitcperiql Sti-s&cr <m4 q .R\Lis4zr aciPii Tifitt
fAzis w3Tfti
(7t) 3TRTNT (6) t 3101-9. Pictci 31-31 tf#MZF1 isfatricitr
ilooly. S mr cict) 14xiifticr cm4 ifaiert Mi 7-4 do ft
TherPi Liigerct)91: S iiI ZN aifiTr 4-4 aFrAr irigercog tit Att w7 air t ai
w-fr b/1,11 ir /Kr fterlt ftftzrt, %tam zur *offii 11q1-1 ZW
t ;
(t) PqPi Ingerm9I t iif S 31faTE tf Tiqi RUM. ,Wa,
f3Lcilflr 74 Ttcw, -sr-sTA ZfF Re)- .114 t 3r--e49 3,r11 rth 1 ,s4 tumvt
S 0-r arrtzrzr -ftcnt -sr-4Tr w@ft,
(thh) 3TRTIVT (7) (t) TttliS ;a% TR, mro *NcoN,
wi-Aer quit A &RR:FT fasfacnau S ThEreA WE rata '4141 mtrfr
-,41 3aRT9r ucparcr fti5t ii4 t fs-Art t faxcAvicitr quferr
TrrAr 3lI1Il 30 -IciDvAicie4 S s'rEraiIThii 74 alcipq4i \icrvr fs-Arw
twjluicp ffiwRr t ffiftu qT44t
3TItTIRT (6) t 31419 ;1-0)--t 3aTT9T, '<NO raTTff 91,5ef
3T-4-91 tTreT ft_41 stilt
56-oi4 i-ks7K t1114-4-1+14 tR. Ycl tf tt falsRit
ffitzr s• ww-di t, arRrfkamS jt.icttht antim 1 /4,)•err
arratat TITS1a Pai ZN arrr-aA fciNviey_r gNf ftzrr wrirw, f'fr#
fdTm 61.)• TR flu-4 tkcopi tf arr S ar-IRTR fazsDvicyrzr
povvr cm4sigl t Trwth I
57a c3 1-1.1 cre1 fit-AT 37-4-4.T 3TVY9 lciR1ciiei4
T4ET-C9'S -Rea i Rcrf4riev-r S atIv timr cwir,
T-errzfr f4f4, \914i1-0 1=4RI zrr 3TRT fAtr UvIT
*114-Acft 3II41vict) Itiitatrd q-04
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

3.34:5553 52,: 5:555 a sunxzmx‘E
EEEEEEEEEE
Efimggwfififlflgfiafigg
Eggggfigflafigfig
figrfiwfiggggwgum
I . iEEEE
Efigflgfigfiggg «fig
E_EEEEEEE§EBE£_EE
mewfiwEwEEfirEgFmfimEmwfifiga
Eggfifigfiflwfigglgggé
_EEEE$E
EwEEE.§sE%¢N@E§Ee
Efibfiwflfiwgflfififififi
EEEBEEEfiEflvfiEE
Eminewwfiegwfirflfifibgmflgfigfiwg
.EEEEEwEfiEEEflsmEE
EE:£E%E%W:SEFE
. Eégfigfifi
EEEEEfiEEEEEBE
_E.Eg5wfigwflafifi5m~§g§§
EEE¥EEE_§E§§Ew§E
wEfiEfiEEEwfiggEEs
. _EE&
ufigfigfigfimfiwflggfififiwfiffim
EEEEWwEEEEmEEEgEE
gaggfiafigfififififihygg,
.Efigfirfigfigrgafimfimgmgéfi
Egggfisggéfigfifiwflwfiwfifis
éfiAmVEEEEmEEEEEEE
fiEEEEEEEEfiEEEE
«Egfiafifiémwfizfiggmfiggfifi
€9g9£m§sgeswfifima§s§a§©
MENE
”EEEEE.§WEEWE€EE®E
.Efiafifigfifieggflpfimggwgg
Egfigwgwflggfigfiflffifigfi
Efigéggfiggfifigfigflgfi
Efigwflfiflégfméfifigé
BEEMMEEEEEmEfingEE
@EfifiEEEEEEE—Efifiwfiflwfi
meow .E w .mva E St VFIVW
sicc(ttI3fl-TRUf1Iu1c, 63P137, 2019 25
f- 4914c4T 61-114
we'er
5841) Tff arfeggff wctiet&t qnqfkcr q4k •flov-1
'MC # 3rlTh419-r W<I I Hick1l l9T Tr-t-th ti
(2) T4Trt41 -0(-04I A ancoor. VM4 iaI1irtkft P41414
f*--iWZgcr 711 t tichtif *yet W15t g
tTNT 4 met 311ETRT (1) I tWilrEgT cfN4
Mg *lag i5T c-i?rr4 ciiT A tit ;
tIRT 4tt 37-TRT (2) t 311n tiReilvtir ftql8 ar---egiz
arR:r ftWt11.;
(Tr) arRi 1-11 4-1a, Tfr 3Tf1ftzT4 arerff Piwwioftgm WO
14)=4 umi zrr tr 31-mt ti
59-(1) '11\34 *NOV( -@11 ffi51t Thlt-gid . -RPitccf: 1-f4vr
timer arf~ wr-4- 11 ik 3arrizi4 -uurnff ufa- tmnpir
3T4ET k 7 (r)t4 sgh-A-9-Ik4 zr6- Ithi tizr*Tft aTRrizrrr
31-rtzr TIM 1**4td arqtr gio-r ar@W:a NEZFEltff -011
TrRw Trftat zrr eilLr vcr er arruzrT zrr ip4)-414 wilt
;Kra
i-Nntzru ft Ti:r aTftikzwr arrRzT 4* f4-9-ET 3:1M qizt Trarff
\I-If 0 .arr-a-ta -R)Lir jiiZIiiit
(2) WIWI- (1) Mit9 R4I TRH lick) 31thT, ftg
ttlIcf 71247471-474 tf1;1 -1 %TM 4iu5ef •414.1I TITIET .tY.af -Wg7TT I.
60-31W4gm f4g4 31:146t gi3111111 tcm1-1 ‘301-1 'tk 0c4
wild tat451 q4eN1 ‘it-cH cravf gkr4 ItRit gpa
q-R)Trr
61-T NtegiFf 3113. ff-4119. c&T Wg iiFIwit 31T-41.4711 3t17
fP0441t zwa-,ET qzcifhilevilt irreau arvviir Wm.gkrei %TR
gl•< 41141 lit ?St 3.TR4 qRr ar-- F4- wr-d grom:a, 61k- gz1
lit spirit 6)
62-(1) "R:f aarfgarf argit 1 21. -ItitY4i147c1 Meggrf
crr-4# 614 rR i*Oci ii4is4 WO" I
3TIE1RI (1) \fc'-eiracr Suitt 1 # TV1'&44d Meg-gift
Thai 614 er 1ft facr aarniPt wiferff quIdtlieril
114 Trzi wrtcr faftrzr ThanRcr arRe4zrk3frAu uur t1416(14zU 3i1iwr7
uP_TT writm TIT Strr 3Ttirff t14-14 v1144) I
.0:1 Arfkg11 ThAlfki Rv)- Mt IThriI4!e14 3P14 iiT614-Ta
IvSäci alkat Ntir9 aTcr4 trfflkalti, Narre-st at17 cisPfccr
34-1--t-cr coli3/4 utiik gq
afepTri critiT \r- Ther 3rer ‘igircH ctN I
63-TH 311eggli 3ra gffl ed-e t4tsccN
;r4Tr .<1,r4 IT 9EI4) 34v4'a'slt gm wad- fdalhievr, ITRff451
Tifdtum rjuih 30 gl.(1 ZIKT 1)xlt4Act)K SWF (Ma .41
VI 7
0t.? mar wrWr
f44T-4.1 Th-T 4 I
srbr
14Kil -taileto
Itzu
ate4trii 51
anrrilet srffra
f4-i-frq a&
wig (wit
Mc41t1
fasaltarga
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

E
flag
mm
€8§§5€$ 523. 5:55 « man—£5.42
EWVEEREEEEEWEMOMEWE.
EE.ERQE§EEEEEWEE
ngmfimfifififigwmgufiagfié
_%EE§%E%EB@E§%E%§
E‘EEEEKEfiEQEfi «E
Eggggmflgrgwma
u _%Egawfisfirwgsfikfl5g
EEEEW.E%EEEE?E
EEEéwgggmg EE
figfigerEmSES
_%EE&E%E%§
Eggéwvgfigficle
a .fimfigg
«mwfiEEExEWEEWEEEEEE
EEEEEEwEfiE fig
.%E_§?Ewfivmvfi§fils
, SE
EEEEfiEEEEEE E
Eggggfigfigrgio
..EEE%EE®EEE%E§§EA
wEEfim‘EEEEwfiEwEEE
.Egfirgfifig
Efigfiwfirflfiwfigfirfiflafiémfig
Efipfiéggfiauwwufifig.§
«Egfigfimfififigsggg
wEfifi&E«EEEwvaEw
Egfigfigfiflsfiwgfiggfiflwfi
EEHEEE;€EEEEEQY%
, . ._mEfisEE
EEEwfimfigEEwggE
. MEEEEE
Erggwfizwggfivgfivk
V mgfiEEEfimEEfivfi
Egfigfiefiflrfiswséfivgfiv
Inm.Efi\mfiwfiEwfiEEEflfiar
EEEEEE.E§EES
.EEEMEEmEmvflarE
.EEEEEEfiEWEEEPmeYfi
ESAEmMEEEEH/Em
26
'iccfl Trat4T 31-4TIVRT +RAC, 6 3PW1, 2019
(Elm 8 t€1)
wo 24 talclIT WI. 79 144 wr Wang
jcflus Atar0711-4TT 1418, 2004. (inn TraTT di 111501 9 19 * Je( ftrearFa, m I
21304). dA11,1111 Rile 27_02_2004
;40-el *Saar d W. anti Ve`ST fiTli, 2005. (ictlt T*4 81FtkITTI RPra Th4flEJld4. I dlitei ,
icit 11-4211 tItell 11 '92005). eRifT,11-41 ftifw 24.3.2005
71 4 RT-41.40-40 . eel( utiT di Reli. 2008. (ielt nu dlIi1q 11.1011.144 14 Ellet 31 1 .,
itit 1112T1 TIT 32'9 2006) dIR*),011. Rife 30.10.2006
1R114 4111.-4 irriall
tin, Th4I€JIcl1I. th‘pt wan 1
9741 Ininft fdreauran . ear( wan oi IN. nu
(aCO( Trau 3114141111 *SIT 29 19 2008). 3TRIV-TI Rum 05.9.2008
42N5 118ic111 Thraf'auran . aff2 wan ,MR4flqq. no& Wu wan 42Inz nbl4l1 Th 'i1awei.
IblAgis tits4T 30 19 2008), daltillT R-lie 05.9.2008 TrII4141 . yawl
21797 RlcIf1I14. 4z-i RT9-47
eel( wan 1
21 fannarnn. ,ialt 0-421 dlRIIktIlt 2009. (iccrt nu 41IIIiHiii9I1T
14 19 2009), daitki-1T Rife 24.3.2009
110R10'0 P41-410711-411. izieli 1742T 4 4i, 2009, ('ant SI*2T dI1?1f1q 4ov11aeo faranran. min.
Ithi 1 1i1381 21 '92010). datitliT Rile 01.9.2010
nett' farearan in wan di tilt 2009. (4cTit Sib! di IT ref 192-4R/TT-40, nef. 'actil
Iran 1
fraragran, qlRiqu.I.L
1-T5TI1 22 19 2010), 3TR1-tr1T R-110 01.9.2010
'11ii4. R.7l1€Jlv1ZI. atnt maw ea 1).K no, (tint( man di 4 -4-424
ictl Tre2T 1 1i1g8T 23 /9 2010), AIRIV-T1 Th-lie 12.10.2010
41/4*-4 $-c/ nier x14affitt, 47 *-CeltileT ant& V99 ithr ..,, 4q. 2010. ('act Tau
Ril'Aiinntnn 27 19 2010), difAntlif Riie 12.10.2010 I itt.gi i , Taut
ii- arrlonoaoRno f'dxidninn. 11110•1 wan arid IN. 2010. ('ann ran anloeno4o[nio faraltaran.
1J04 911911 24 19 2010). dAtte-IT R-94/ 12.10.2010 -n 34thnffr 4413-( 1 ,
An, ligmiiic 1
4 km-ann fdrarcargn. 9U1aV1r
Anto nrn I
-ti faraaran,
4 4022,2a frralWarnit, nm‘ van .sifP N. ado. ('attic Trau
dII PI1IB 3433111 26 19 2010). diMirlif R-114/ 12.10.2010
.wrq, 4 ATTT faelnele10. a99 wan 4IIbf.1q. nu), ('ante Iran nix tttefl r
'aiRiPiiq itnn 25 wr‘ 2014, dif4121-11 Rile 12_10.2010 deal* I
4faith4 f4xede1le14, daft rain at qq. nu. (oct11 Iran aiRflqq Io1i1Iqu'.rfanfaufgq,
/OA1 14 19 2011). 41910-17 Rii4/ 07.4.2011 I T1914 1
15- t 1.424Th lea. tailt irtsr di cm, 2011, (dal( 0-411 dlRlPj.lq 11-110t el €114 . 414 ,
10911 12 19 2011) datt:4-17 Rile 21.6.2011 I 49141 i I
is- oft Item*,i 4'iIkqvq RMautot'& 41 ,(Illana 114Rqut faraway, um‘ war di /N. 2011
(4c4t Mtn diRATPT Itt9TT 1 19 2012), diRtvilT Rile 04.7.2012 11
12- 18,414 ar4 n 5 fanftaran, -4-TI 116J94. 3141 nta Attila 1447 Vfft 0di 49. 2005
(unit wan nf0fAlor nnw 19'9 zoos). qAttypff Rule 19.6.2006 1191 1
of (1)cf Ti, 4 , 374t di Ii . 9. •qater allfit . nwz 1242T 41 11$1. 2011
(sitet Itu 0141;98 ittRIT 2 IR 2012). eRitt.141 05.7.2012 t15111% 1
win farearran, nw-f nu di 441, 2013 WIT fanitaraz. wrntg I
(two nu oladt;871- U9981 1 19 2014). di Is •ff Rut 10.01.2014
911f7fd faraman. am' wan arliteavq. 2011. (oct11 van oiMI.tq*ma luRid faraltaran 44n,
3 19 2012). tattalif ft-ii. 05.07.2012 *MI 1, I
Q41 fardtam8. UM itil dIEPnIq. 2014. (0crlt 9-4W .jihtiRiq.i Uliu 8 Q41 ThqIaioiq. dit Uffi
Irani '9 2014). dalto-17 f8-17* 04.3_2014
4Kno faraaran. flin 61414. fibq MIMIC az wan n qq. 2015 4o[nio xo rang, Ilya bt I .
(aMq 0-4W 31R1fta1ll W(3/if 719 2015). dlIbtLePfl f4-41* 24.6.2015 Si I
n- antoartokmotto 74 U100. itur UM rim ailbPlqq. 2016 aricantoRquao faraway, Oa.
MI Tau I (aw wan adbfganr nun 32192016). attnir fanin 03.10.2016
442 tcl 1071 718.9 Riff UM IMF di LPL 2016 tau Pazattaran. 4z‘ i ‘ .
('anti 9-4/1alltegazI 1t8211 2419 2016). 41fRIVI-R fkurt 16.9.2016 1 09161 I
utat ock a1-1ef ThqThuua. VM litif arlithan 2016 ital 8 CI ail .
TIM I (eclat nu arfite4:4 au 28 WI 2016) aiRito-11 ref. 16.9.2016
iiuki0 ThqThuiouq. UM, 7171 UM 17411 do WI. 2016 - tit% n Enci . STK 7n9T1
(aff: nu amizan num 20 WI 2016). aitZ)tri-ff ftgre 16.9_2016
Are fanfinran w€24-* nfff nu aft1141171, 2010 (3M lift 741191:408 1191 tillalt91ot8, WEIWW, MI AN I
472871 27 89 2016), 0R141,0-11 Eta 18.9.2016
191_RPH_Dala 4 Vidhaika Folder (Adhioiyam_2019)

WWWW,6W, 2019
«11110—1
(511111 a 721?)
'— afifimmfia‘m
WWW 2004, (05.1055015102111QO
2004)31h'1fi1=nfiwz1.022004
ZMWHWWW 2005,(am97‘2131%
11121111 1112005) afiifimfiwm 24.12005
WW, mfiuififiufi. 2009 Wfiuaflfifivm
mammogmmmmmos
WWW
WW.WI
WWW. 131111131111.
mm”
minim
WWmmmoa),mifimfimas9moa
6— WW, mmm 2009,5101me
141112009), WWngooe
7~ 0110031000 Mam, Wfiflafifiu‘m 2009. (ERR aim 31W
11150121912010). WWOLMON
0— WWWEEIW. 2009. (emu—"331m
11811221112010), WW0191010
9— fire {020mm,mfiua1fifi1m 2010, (Bavuéumfifilm
11190231112010) Whammjozmo
10— WWWVEW, 2010. (afifivfil
4A mfimmfififiam.wmqhfiumzuna FWWW
(ammmfiuwmzefizwa).m1fimfiwffios9zona W, #13. W11?!“
5— fiafimfiwfim.mvfirm.moa,fimwfil Mmmhfifiam.
w,muéwu
311131 WW. Em,
Jam-1972111
0110931000 W. 112:0, am
1172!“
mm. fifih. am
1112211
Wm. WW3.
lama?!“
WWI—13512115131,
sz‘lmmw), WWuJo-mo 1110111251711, 9101111911
11— méowoé‘mnm W. W 11—531mm. 2010. (BER fin eroWoaotwo fififiafivm
313mm! m 21 111 2010),:11fir1fim m 12.102010 film an W W. W
11:. 1131211111
mififlfifim.mfiumfifiim 2010,(afir19§¥1
Wuhanmmw). Whammwmw
mifimmfilfimnfilfi
(31—111 11%?! mam-1 11w 1 111 2014). War R1131 10.01.2014
WW. m“ 31W. 2011, (am WWW
3 in 2012). 31mm W 05.01.2012
«MW, mfiafifi‘n‘m 2014. (amfiafihmma
11—1 2014) 01mm: Rm 0432014
W. WW 93551515001015
finfifimhfifi'fimmfinififim 2010 (Gawain “Mam—ham.
Withsmzo10).mfi=1mu102mo m1
mwflmmm 2011 (9611mm WWW.
man 14 W 2011), «101521 was 01.4.2011 WWI
'W.Wufirqfihm.zo11,(amvfiarf§fim WW,W.
111911 1211:12011)afinfi=11fi=11‘621.0.zo11 WWI
ahmm—fififiam.mumum 2011 slim—mu? hfififim,
(ammamfiwww‘m1 1112012),a1fimfifi1'7604j.2012 1R1???“
www.m—fium.ms Wmfifivfififiam
(ammafimmmmmlafimm 19.6.2006 my“
afiWWufiEfihfl,mn EWW,WW
WWWWZWZMZ),WW 05.7.2012 m1
“Mia-1mm. 201:1 mhwfifima’n.mgn
(amfiuafifimmnfim1s).afiwfifiwmnzo1e
(ammafimnmrmzms). afimfimaizmzms Mam-0|
316W. WWW, 201s -' “#0911060 mm ha
-« 5mm
mmmm:.mm1s).mmm 19.92010
WWWW,E10
(ammmmzsfime)afimfim1s9ms
9101mm T’wzm »
(amuéuahfiwmzofizo1s)afimm1s92ms
mnfim10)afifiimfim 1992010
l9l_RPH_DaIa 4 Vidhanm Foldet (Adlliniyam_2019)
‘,Icck Trat4T.31R0V1R7 lut , 6 arTiTT, 2019
rat-2
(4137 7 ts1)
wo
fdscif4cueia wr km m-r Awl'
4, -1M I
Oiler 100 eilei4 81?4ffi101, 2004, gen 44 Von 9 179 *
MN
2004), 4A1,1111 R-1(4) 27.02.2004
\ a •
94-111e,
Ord./ ReXT I
V lINA feredRITH9, qa“ Wen 311i2119421. 2005. ( ukur 4IRIPI.lq
iienT 11 1I9 2005), datEreff Rik/ 24.3.2005
)1ldIJ4cM Arderardu. 31 1id, Ocrie
;in I
1111c41/444 Xri WW1 , sicti wtr 31R1f429, 2006, ( tie Re!!
,MRIPiII 'T ti(en 32 19 2006) 4Atkelir Rule 30.10.2006
inn
An-et forofearva. 9741 Cdaell-4 Triredl ThlqRcJielq , Ord wen 311n1949 2008
49, Out/ miw I
('init Ilan 4A1)1111 VVIII 29 29 2008), aikellf Rif co 05.9.2008
Mn b
I el q.
af7I9 Tra412 fdTeniwi , 4ccie '2 air 3161 q , 2008 ( We utur
3111PI1B t1(5111 30 29 2008), 4•1ttel4T Rife 05.9.2008 9(141414, Orcie 174n I
i,ic,ir faraarKii.
1IZ1 trdi, %tall
wen!
111(41 RXri1delle14. Out/ yen 'IIRIPflIH. 2009, lita 31Qill4119
nun 14 T9 2009), atkelli f'd-914) 24.3.2009
Ank1
F020 fiqlulvi4, 117121, Occie
11221 I
11:12-9020 ferednivv, Ocrle Wen 3112.11"429, 2009, Ten
oi1Piiii iteRIT 21 19 2010), silb9,e111 Rile 01.9.2010
eqftei RviIui0iq. a •scrit
lien!
*flat! fornteriv4 Ocrle inst di q . 2009, Sten 311412.494
1n5111 22 219 2010). 3TItifFqi Rue 01.9.2010
A Aqu Tail . Arawau.
ultuc, <tan
veXT I
Hine foraviv4. vIcrie IfeST 311nt499, 2010. utur
'(s41 23 19 2010), daltellf Alirl) 12.10.2010
flu. i \ q. * wq-a- tPiqfllcft. 9112-41 *-Ce•IXI-Ice 104 . tirele raw ait1i.pi. 2010. ('nil
diArAtIg 2423111 2719 2010), RIntkeill felirn 12.10.2010 li 049.04 ie. elcde IteXT I
11-'
arr4outuotTourfo Autkurda. oast/
f4erft 4g,
39402160inV90 Thiqkweit ticcie Ian di q . 2010. ( We wan
altreduu itgur 24 29 2010), 4A9,)(1-17 Rik) 12.10.2010 MR WIT( •quiciti,
isaqiql< I
4 t fdrecarKii,
+NAO.
4o4to kin I
Al km-ture faZO 131(44. eIrrie veil 31R1XIN, 2010. e wen
,dIPIil #50T 26 29 2010 diAvi-Ir Rule 12.10.2010
art 49134 u-e fdgaid
Reek ell nen) 9TTI feravall, Ott wen RlPi11IL 2010. (tele wen
3111119471 20341 25 29 2010). 31149,1•11- R-11.5 12.10.2010 tenth I
faraard-a. lei lh4
11e111124141 MVO eitc14, Ocrle raw di . 11 , 2011, ( tell rat
421 212RIT 14 29 2011), 4A11,o4T Ruts 07.4.2011 11 01194-1 lel
In
truarduran. 14.11.
00:1116e faetrarreit, elcrie wen JIRIPiPI. 2011, crie wen 3Fite444
Tinn 12 29 2011) •SAVI-11 Rik) 21.6.2011 11 0.141 VII
41 •(19 9 Arama. an 119trien4 11 rice fdraviv-4. O wen fA4111, 2011
neirirtn I .
(Ocyle wen 411"a)421 Vent 1 29 2012), atellf R114) 04.7.2012
'S 6"1C
i Aueturdt
991-11< 31-41 41 9i Ardftardu. •Scri Wen d&JPIIPL 2005
eine I
('iccit i;rtur ..eaAtid nv111 19 219 2006), toir A-110 19.6.2006
18— V
9, tt. ea4 cnerw.
q icasof 704 , qccir lien iIWIPIPI. 2011
11912-19e I
(Ocrle ;WI 411W)411 inRIT 2'9 2012). tiiiiqi R-110, 05.7.2012
FRIT faredurdu, euuI WTI ilvard le14. Orrle Men 41 11 , 2013 •
(ttcrie Wen siMAiik ituur I kru 2014). toir Alia, 10.01.2014
Uklu. 1
.2211im faXeirdelim4. Onle wen di il , 2011, e wkir N14411 si
*I x-it(
Itairdwgzi. 44 all. lel 'nit
TetRIT 3 29 2012), atkei-IT Ruts 05.07.2012
441 feted-awl. Ocrie wen 41 WI, 2014, ( SWF aIRAqii
utur I *nil 8'9 2014). 41Ritkeln R-Ii0 04.3.2014
tree 11, firsturart.
14/11)41414 I
4Krao faxgracutia, fOrsterarq, Thrc uiiiiC 'int'l ukur Att 2015
(.scur irtsr diAAmt 4734T 7 29 2015). 41 924-11 RIIM 24.6.2015
aw4o3Triorrotto Arditarek km, autoarrioenotto AvaR le14, tiv VW Tien if. 2016
12111( fill uta 4AAmi utgur 3219 2016), ratkellf Quirt. 03.10.2016
tke fkratuat ileu utrm, Ike Araurdu. Uri i mdr u--au ran di q . 2016
11 01190-111e
w-avr 441-Anw Trfizif 24 39 2016), iiRi*tuur Rue 16.9.2016
WMI 9oc,c.hiuoicarawat wi-al 1
4int 4 x4Xinte AredEu-du. a-mu sitin q. 2016
(sca( Ten 41109114 205117 26 29 2016) dSltjur Rule 16.9.2016
2rtikfa ftretarat srm. =nun Tinhga RiqRclI&L WRIT, MTV VW ithr a4 . 2016
t 114V1 diNAuu IttnT 20 29 2016). 31149,1141. fell. 16.9.2016
'nu re tkvamwa. an. zr—i 1 2T1 RtqIZuici4. Wffn VW rail di q . mut at( wain
41Tflqq ite17 27 29 2016), 31R1t041 Rile 16.9.2016
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWW,6W,201Q
27
11331 2110101111 Wall 20 E 2010). W 12:11:: 10.9.2010
mifi—z
(firm 7 3!?)
am 31W an fimvr Wm an an
1— mafia—01110011019100.2004, Wuwmfiuwfiwgm www.m1 J
2004), Wm fi—vn‘w 27.02.2004 ‘
2— Eqfiflfifififlm,mfiuafifim1zuos1wfimafim MW,W§§W
1119111 11 W1 2005), W W 24.32005 W 113311 __I
:— WW‘WWW,ZOOS,(WV3H WW,W,W
3101mm Wm 32 W1 2000) W 12110 30.10.2000 973!”
4— WWEWW,WWW,2003 WWWWJ
(W W M 112501 20 W1 2009), 91W Ffififi 05.92000 W. W “73‘“
5— NWWWW,WWW,2009WW Wmmfifififlm.
W m :10 W1 2000), W W 05.9.2000 , ERR 1173211
0* WW,WWW.ZOOS.WWW WW,fia=fiqa-1,m
Wen 14 W1 2009). («film W 24.3.2009 973311
1— 11110031000 mm, W 0331 01W, 2009, (afirx' W231 momma Wham, 112m am
311211211111 man 21 W1 2010), W?! W 01.9.2010 Jim
0— WWWWW.2009,WE€HW WWI-111122110011
Wan 22 W1 2010), 311211131711 W 01.9.2010 a?!“
9— mw,wuéwafifiuwzmo,(afifimm Tmmm,mmm
Wan 23 W1 2010), W F5116 12.10.2010 T8311
10— WW1W,WWW, 20101970191231, 010313???me
31W 111911 21 W1 2010), W W 12.10.2010 4 mm. W 11??!“ __|
11—' 31110016030090 W, W r331 31W, 2010, (am 01221 “009506100210 Wm, 3117517
01121101111 m 24 vi 2010), 3110113121 1231'? 12.10.2010 61W 311111133 was, m 213,
ml
12— an tin—em Wm, W 92:1 W, 2010, (ac—<11 m 11'! am ham, 091112-11
mm man 20 W1 2010). 3110113121 W 12.10.2010 @0010 WI
13— «Mammalwfimaflhfitmzomfimm :11me
W m 25 W1 2010), 01121331711 W 12.10.2010 61191371
14— www.mmmJouWfim WWW
mam “Wan 14 W1 2011), 3113113?" 0:05 01.4.2011 Wm
15— Wham,wmmm,zo11,(amma®fim WW.mfi
11w 12 W1 2011) W W 21.0.2011 WWI
10— mmflfiflmfififimfl.mfium,zm1 mmfimhfifimfiw
(3W W W Wan 1 W1 2012), W11 Rm? 04.1.2012 WI -
17— Wmfiafimfl.mufiumfiuwzms Twifififififlfififififlm
(am 9?“ mm“ "Wan 19 W1 2000), W W 19.6.2000 WI
10— afifimfiafiffl.wfiwafifiufi.znn amma,mm,
(«RR 9%?! mm m 2 W1 2012), W R711? 05.1.2012 WI
19. [WW.WWW,ZO13 - www.mgvl
(BER m 3101101111 WW 1 W1_2014), W am 10.01.2014
20— WW.WWW, 2011, WWW :l www.m1
man 3 W1 2012), W Rm? 05.01.2012
21— rafifimfimm.mfiwmfiw,zou,(ammafifiw WWW,WW
Wan 9 WI; 2014), 9111113?! WE 04.3.2014 ml
22— 6100-00 mm, W, MW W res! aflhfim 2015 01012110 Emmi-m, madam,
1 Mean rear mm Wen 1 W 2015), «figs—~11 Feats 24.0.2015 W1
23— “Woman Wm, #73 W 11311 01min, 2010 ,eméoméowfio Wham. 111a,
(am fin mm m 32 W1 2010), W31 W 03.10.2010 W 1173!” '
24—Tfizfiwfiam,dammmafizfi1mzms www.1aarm
. (am flu m We" 24 W1_2010), 911033711 P0111: 10.9.2010 Jmm
25— fiiflsvafimafiufium,mmmfin,m10 WWW,MI
(am 1172!! 111010011 11190 20 $5 2010) am" W 10.9.2010 f'
I" Wm,m,mmmmfim.zme mm.m.m1
19]_RPH_DuIa 4 Vidllaika Folder (Adhiniyum720l9)
20—
(am
21— whafium,mamw€uafifim. 2010, (01mm
31mm Watt 21 W1 2010). W W 109.2010
100 mm, m, Wham
28 ‘3c;t1 ra-71. 31- l1tTRT qvid, 6 3PTRTI, 2019
w-c—a-vg atti- cmui
f14-4- 06 9b-701, 2008 M 3Thit9 iii4c1ct, Ricwcif *3-TTIN itfr19"
gkl •t1crn4ti f411 'NY41411(-14 .P.ITferff k InPct -14)?.1 Tit 1 tit
vo sum . *ftRr9 aftatri fer tat -4 1'4* faxcatheiiI* augaur : ' -
CO ‘9411 37-4-4.T 1651 t I 3M.: 31-49T Tur afftrr 34-TA-grd <N4 30 \ivel 9-1411# luicivetr
Trr-44- Mv4iPticr <re4 mytf sttcbr( Th°1 nriim agiAcrcflllum wq-- <frog.
mitfftrirtrrti
ardkr4 fst cr- 1 fa 31119. witti o e
31itaT aitrfttriT emief ‘3114 m -W)Tizr fstrr Trar 1
acltir( \icc-PZ Maxi' ffilf Rzeiravieuf it-)zfT, 2019 7:itt1fferd. fbir wild( t I
aTrur
o
glur tiNcri
No. 1451(2)/XX IX-V-1-19-1(Ka)11-19
Dated Lucknow, August 6,2019
IN pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is
pleased to order the publication of the following English translation of the Uttar Pradesh Niji
Vishwavidyalaya Adhiniyam, 2019 (Uttar Pradesh Adhiniyam Sankhya 12 of 2019) as passed by the Uttar
Pradesh Legislature and assented to by the Governor on August 5, 2019. The Uchcha Shiksha Anubhag-1
is administratively concerned with the said Adhiniyam.
THE UTTAR PFtADESH PRIVATE UNIVERSITIES ACT, 2019
(U.P. Act no. 12 of 2019)
[As passed by the Uttar Pradesh Legislature]
AN
ACT
Short title, exten
and
commencement
to provide for establishment of new Private Universities and incorporation of
existing Private Universities in the State of Uttar Pradesh under this Act for imparting
higher education and to regulate their functions and for matters connected therewith or
incidental thereto.
Jr Is HEREBY enacted in the Seventieth Year of the Republic of India as
follows: -
. 1. (1) This Act may be called the Uttar Pradesh Private Universities Act, 2019.
It shall extend to whole of the State of Uttar Pradesh.
It shall come into force on such date as the State Government may, by
notification in the Gazette, appoint.
19I_RPH_Data 4 Vidhaika Foldv Adhiniyam_2019)

BEN 9&5 WWW Jae, 6 31‘ W, 2019
WWW
' Wfiaimoswnfr zoosnmmmfimfififimr
Wmmfinfifimfimfiflmfinqfifivfinfifinfifirifiififiwr
ammeammeemmemwmmmemmgg
afiéwmafi§a¢wmaflfiammafirfifimfi§mfinn
Wafifimfiwflfimwafififirfirefifimfiamwfimm-
mfins‘rw‘é’r
wwwamamwmmawmmg
mmmmmmmwer
mefinfifimfiwfimaoigfiwfiammer
611311 it,
no dro Rig-II,
age Hfirar
No. 1451(2)/l.XXIX-V-l—l9-I(Ka)l 1-19
Dated Lucknow, August 6, 2019
IN pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is- ‘
pleased to order the publication of the following English translation of the Uttar Pradesh Niji
Vishwavidyalaya Adhiniyam, 2019 (Uttar Pradesh Adhiniyam Sankhya 12 of 2019) as passed by the Uttar
Pradesh Legislature and assented to by the Governor on August 5, 2019. The Uchcha Shiksha Anubhag-I
is administratively concerned with the said Adhiniyam. '
THE UTTAR PRADESH PRIVATE UNIVERSITIES ACT, 2019
(UP Act no. 12 of2019)
[As passed by the Uttar Pradesh Legislature]
. AN
ACT
1 V
to provide for establishment of new Private Universities and incorporation of ~
existing Private Universities in the State of Uttar Pradesh under this Act for imparting
higher education and to regulate their functions and for matters connected therewith or
incidental thereto.
IT IS HEREBY enacted in the Seventieth Year of the Republic of India as
follows: -
Shgn title, extent ‘ .- 1. (1) This Act may be called the Uttar Pradesh Private Universities Act, 2019.
an
commencement (2) It shall extend to'whole of the State of Uttar Pradesh.
, (3) It shall come into force on such date as the State Government may, by
notification in the Gazette, appoint.
19I_RPH_Data 4 Vidhaika Folder \dhiniyam_2019)
\Jcek 14 xf 3TRITUNuT 4 iv1d, 6 31-711T1 2019 29
2. In this Act, unless the context otherwise requires,- Definitions
"Academic Council" means the Academic Council of the University;
"AICTE" means All India Council for Technical Education established
under section 3 of the all India Council for Technical Education
Act, 1987;
"Board" means the Board of Faculties, Board of Studies and the
Planning Board, or any other Board of the University;
"CSIR" means the Council of Scientific and Industrial Research, New
Delhi, a funding agency of Central Government;
"Department" means a Department of Studies and includes a Centre of
Studies and Research;
(1) "Director" means the Head of an "Institute", "Centre" or "School", or the
person appointed for the purpose to act as such in his absence;
"DST" means the Department of Science and Technology of the Central
Government;
"Employee" shall include teaching and non teaching staff of the
University;
"Executive Council" means the Executive Council of the University;
"Faculty" means a Faculty of the University;
"Governing Body " means a• committee constituted by the sponsoring
body;
(I) "Hostel" means "Scholars/Students" Hostel of the University;
"ICAR" means the Indian Council of Agricultural Research;
"Institute/School" means an Institute or School established by the
University in accordance with this Act and the Statutes;
"MCI" means Medical Council of India constituted under the Medical
Council Act, 1956;
"Minority Private University" means a Private University established by
a religious or linguistic minority of the State of Uttar Pradesh;
"NAAC",means the National Assessment and Accreditation Council;
"NCC" means National Cadet Corps;
"NCTE" means the National Council for Teacher Education under the
National Council for Teacher Education Act, 1993;
"NSS" means National Service Scheme;
"PCT" means Pharmacy Council of India constituted under section 4 of
the Pharmacy Act, 1948;
"Chancellor or President", "Pro-Chancellor or Vice-President", "Vice-
Chancellor" and "Pro-Vice-Chancellor" means respectively the
"Chancellor" or "President", the "Pro-Chancellor or Vice-President" the
"Vice-Chancellor" the "Pro-Vice-Chancellor" of the University;
"Prescribed" means prescribed by Statutes;
"Records and Publications" means the Records and Publications of the
University;
191 RPH Data 4 Vidhaika Folder (Adhiniyam_2019)

Wmmwmmm, 2019 29
- 2. In this Act, unless the context otherwise requires,- Definitions
(a) “Academic Council" means the Academic Council of the University;
(b) “AICTE” means All India Council for Technical Education established .
under section 3 of the all India Council for Technical Education.
Act, 1987;
(c) “Board” means the Board of Faculties, Board of Studies and the
Flaming Board, or any other Board of the University;
‘(d) “CSIR” means the Council of Scientific and Industrial Research, New
Delhi, a funding agency'of Central Government;
(e) “Department” means a Department of Studies and includes a Centre of
Studies and Research; ' '
(1) “Director” means the Head of an “Institute”, "Centre" or "School", or the .-
'person appointed for the purpose to act as such in his absence;
(g) “DST” means the Department of Science and Technology of the Central
Government; '
(h) “Employee” shall include teaching and non teaching staff of the
University;
(i) “Executive Council” means the Executive Council of the University;
0) “Faculty” means a Faculty of the University;
(k) ”Goveming Body " means a committee constituted by the sponsoring
body;
(I) “Hostel” means "Scholars/Students" Hostel of the University;
(m) “ICAR” means the Indian Council of Agricultural Research;
(n) “Institute/School" means an Institute or School established by the
University in accordance with this Act and the Statutes;
(o) “MCI” means Medical Council of India constituted under the Medical
' Council Act, 1956; ‘
(p) "Minority Private University" means a Private University established by
a religious or linguistic minority of the State of Uttar Pradesh; '
(q) » “NAAC”‘means the National Assessment and Accreditation Council;
(r) “NCC” means National Cadet Corps;
(s) “NCTE” means the National Council for Teacher Education under the
‘ ‘ National Council for Teacher Education Act, 1993;
(t) “NSS” means National Service scheme;
(u) “PCT" means Pharmacy Council of India constituted under section 4 of
the Pharmacy Act, 1948;
(v) “Chancellor or President", “Pro-Chancellor or Vice-President”, “Vice-
' Chancellor” and “Pro—Vice-Chancellor” means respectively the ~
“Chancellor” or “President”, the “Pro~Chancellor or Vice-President” the
“Vice-Chancellor” the “Pro-Vice—Chancellof’ of the University;
(w) “Prescribed” means prescribed by Statutes;
(x) “Records and Publications” means the Records and Publications of the
University;
l9I_RPHVData 4 Vidhaika Folder (Adhiniyaln_2019)
30 kiCth SlY1 31W11%117u1 qui( 6 31-Ter, 2019
"Regulatory Body" means the statutory bodies established by the
Central Government from time to time such as University Grants
Commission and includes the All India Council for Technical
Education, the Bar Council of India, the Distance Education Council,
the Dental Council of India, the Indian Nursing Council, the Medical
Council of India, the National Council for Teacher Education, Central
Council for Indian Medicine, the Pharmacy Council of India;
"Schedule" means schedule appended to this Act;
(aa) "Sponsoring body" in relation to a University established under this Act
means :—
a Society registered under the Societies Registration Act, 1860
(Act no. 21 of 1860);
any public trust registered under the Indian Trusts Act, 1882
(Act no. 2 of 1882);
Conditions for the
establishment of
the University
or
(iii) a company registered under the Companies Act, 2013 (Act no. 8
of 2013);
(ab) "Statutes", "Ordinances" and "Regulations" means respectively, the
Statutes, the Ordinances and the Regulations of the University for the
time being in force;
(ac) "Student" means a student enrolled with the University;
(ad) "Teacher of the University" means Professors, Associate Professors,
Assistant Professors, and such other persons as may be appointed for
imparting education instructions, or conducting research in the
University and are designated as Teachers by the Ordinances;
(ae) "Treasurer", "Registrar", "Finance Officer, "Controller of
Examinations", "Librarian" or, "Proctor" means respectively the
Treasurer, the Registrar, the Finance Officer, the Controller of
Examinations, the Librarian or the Proctor of the University;
(at) "UGC" means University Grants Commission established under
section 4 of the University Grant Commission Act, 1956;
(ag) "University" means a Private University established or incorporated
under this Act.
3. The sponsoring body shall, for the purposes of establishing the University
under this Act, fulfill the following conditions, namely:-
create a Permanent Endowment fund with minimum of Rs. 05 (five)
crore;
duly possess contiguous land of minimum twenty acres in urban areas
or fifty acres in rural areas earmarked for the University:
Provided that, the sponsoring body shall not sell, transfer or lease
out such land or any part thereof and also shall not use it for any
purpose other than the purposes mentioned in this Act for the
functioning of the University:
Provided further that such land shall not be mortgaged to any
person other than a bank or financial institution established under any
law for the time being in force for any purpose other than availing loan
for establishing the University;
91_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

W WW Tl'fi'c', 6 W, 2019
(y) "Regulatory Body" means the statutory bodies established by the
Central Government from time to time such as University Grants
Commission and includes the All India Council for Technical
Education, the Bar Council of India, the Distance Education Council,
the Dental Council of India, the Indian Nursing Council, the Medical
Council of India, the National Council for Teacher Education, Central
Council for Indian Medicine, the Pharmacy Council of India;
(2) “Schedule” means schedule appended to this Act; .
(aa) "Sponsoring body" in relation to a University established under this Act
means :A
(i) a Society registered under the Societies Registration Act, 1860
(Act no. 21 of1860); .
(ii) any public trust registered under the Indian Trusts Act, 1882
‘ . (Act no. 2 of 1882);
-or
(iii) a company registered under the Companies Act, 2013 (Act no. 8
of 20l3); - ‘ '
(ab) “Statutes”, “Ordinances” and “Regulations” means respectively, the
Statutes, the Ordinances and the Regulations of the University for the
time being in force;
(ac) “Student” means a student enrolled with the University;
(ad) “Teacher of the University” means Professors, Associate Professors,
Assistant Professors, and such other persons as may be appointed for
imparting education instructions, or conducting research in the
University and are designated as Teachers by the Ordinances;
(ae) “Treasurer”, “Registrar”, “Finance Officer”, "Controller of
Examinations”, “Librarian” or, “Proctor” means v respectively the
Treasurer, the Registrar, the Finance Officer, the Controller of
Examinations, the Librarian or the Proctor of the University;
(at) “UGC” means University Grants Commission established under
section 4 of the University Grant Commission Act, 1956;
(ag) "University" means a Private University established or incorporated
under this Act.
Conditions for the 3, The sponsoring body shall, for the purposes of establishing the University
embl'smm °f under this Act, fulfill the following conditions, namely:- ' " ‘
the University
(a) create a Permanent Endowment fund with minimum of Rs. 05 (five)
crore; ‘ ,
(b) duly possess contiguous land of minimum twenty acres in urban areas
or fifiy acres in rural areas earmarked for the University:
Provided that, the ”sponsoring body shall not sell, transfer or lease
out such land or any part thereof and also shall not use it for any ,
purpose other than the purposes mentioned ’ in this Act for the
functioning of the University:
Provided furflrer that such land shall not be mortgaged to any
person other than a bank or financial institution established under any
law for the time being in force for any purpose other than availing loan
for establishing the University; '
l9 l_R.PH_Data 4 Vidhaika Folder (Adhiniynm72019)
\iccV A—kW 349It11VUT 1IJ1( 6 31W1, 2019 31
construct on land referred to in clause (b) buildings of at least twenty four
thousand sq. metres carpet area, out of which minimum fifty per cent shall be
utilized for academic and administrative purposes;
install equipments, computers, furniture, assets, infrastructural facilities other
than building mentioned in clause (b) and other consumables and non
consumables of minimum Rs. 2 (two) crore in offices and laboratories in the
building referred to in clause (b); and an undertaking of procuring the
computers, furniture, assets, infrastructural facilities [other than building
mentioned in (b) above] and other consumables and non consumables of
minimum Rs 6 (Six) crore in the next 5 years;
appoint Professors, Associate Professors and Assistant Professors as
prescribed by the regulatory bodies and supporting staff members in every
department or discipline. At least seventy five per cent of the regular teachers
in each department/discipline shall be regular employees of the University;
purchase of books, periodicals and online resources worth Rs. ten lakh every
year in the library:
Provided that in case of shortfall of expenditure to Rs ten lakh it shall be
met in the next year;
arrange co-curricular Activities, extracurricular Activities, debates,
competitions, quiz programs, sports, NSS and NCC for the students as per
the standards of regulatory bodies;
conform to standards, conditions and Regulations set by UGC, AICTE,
NCTE, BCI and other regulatory bodies established by the State Government
or Central Government;
establish a provident fund for the employees and teachers of the University
and to introduce other welfare schemes;
make the Statutes, Ordinances and Regulations for the administration and
functioning of the University;
any arrangements made by the University shall not be inconsistent to the
provisions of this Act and regulations of the regulatory bodies;
to ensure transparent functioning of the University and shall put the
clearances obtained from the Regulatory Bodies in the public domain;
furnish information to the State Government as per format and periodicity
required by the State Government;
comply with the norms set up by the State Government for common
academic calendar, anti copying measures, admissions, examinations,
degrees and certificates etc. ;
the transparent procedure and standard of admissions and fee structure in the
University shall be decided and placed in the public domain before the start
of the admission process. The last date of admission shall be as per the
common academic calendar; -
Admission policy of foreign students shall be decided by the Executive
Council of the University and shall be consistent with the standards laid
down by the State Government and Regulatory Bodies;
follow the Common academic calendar as may be prescribed ; and
to undertake to fulfill such other conditions consistent with this Act as may
be laid down by the State Government before the establishment of the
University;
191_,RPH_Data 4 Vidhaika Folder (Adhiniyain 2019)

(C)
(e)
(f)
(g)
(h)
(i)
'(i)
. (k)
(1)
(p)
(q)
(d).
WWWW,,6W,2019
construct on land referred to in clause (b) buildings of at least twenty four
thousand sq. metres carpet area, out of which minimum fifty per cent shall be
utilized for academic and administrative purposes;
install equipments, computers, fumiture, assets, infrastructural facilities other
than building mentioned in clause (b) and other consumables and non
' consumables of minimum Rs. 2 (two) crore in offices and laboratories in the
building referred to in clause (b); and an undertaking of procuring the
computers, fumiture, assets, infrastructural facilities [other than building
mentioned in (b) above] and other consumables and non consumables of ‘
minimum Rs 6 (Six) crore in the next 5 years;
appoint Professors, Associate Professors and Assistant Professors as
. prescribed by the regulatory bodies and supporting staff members in every
department or discipline. At least seventy five per cent of the regular teachers
in each department/discipline shall be regular employees of the University; '
purchase of books, periodicals and online resources wonh Rs. ten lakh every
year in the library:
1 Provided that in case of shortfall of expenditure to Rs ten lakh it shall be
met in the next year;
arrange co-curricular Activities, extracurricular Activities, debates,
competitions, quiz programs, sports, NSS and'NCC for the students as per
the standards of regulatory bodies;
conform to standards, conditions and Regulations set by UGC, AICTE,
NCTE, BC] and other regulatory bodies established by the State Govemrnent
or Central Govemment;
establish a provident fund for the employees and teachers of the University
and to introduce other welfare schemes;
make the Statutes, Ordinances and Regulations for the administration and
functioning of the University;
any arrangements made by the University shall not be inconsistent to the
provisions of this Act and regulations of the regulatory bodies;
to ensure transparent functioning of the University and shall put the
clearances obtained from the Regulatory Bodies in the public domain;
furnish information to the State Government as per format and periodicity
required by the State Government;
comply with the norms set up by the State Government for common
academic calendar, anti copying measures, admissions, examinations;
degrees and certificates etc, ;
the transparent procedure and standard of admissions and fee structure in the
University shall be decided and placed in the public domain before the start
of the admission process The last date of admission shall be as per the
common academic calendar; '
Admission policy of foreign students shall be decided by the Executive
Council of the University and shall be consistent with the standards laid
down by the State Government and Regulatory Bodies ;
follow the Common academic calendar as may be prescribed ; and
to undertake to fulfill such other conditions consistent with this Act as may
be laid down by the State Government before the establishment of the
University;
191VRPH_Data 4 Vidhaika Folder (Adhiniyam 20l9)
32
\lccH Y1 31-R1111771 , 6 31-1 1, 2019
Submission of
proposal for
establishment of a
new University
(r) to undertake neither to be involved nor to permit anyone to cause or
promote anti-national activities inside the campus of the University or
under the name of the University. In case of any such activity found in
the University, it shall be considered as a major violation of the
conditions of setting up the University and the Government may take
action according to the provisions under this Act or any law for the time
being in force.
4. (1) An application containing the proposal and the project report to establish
a University shall be made by the sponsoring body to the State Government along with
application fee as may be fixed by the State Government from time to time.
(2) The project report must contain the following particulars, namely:-
the details of the sponsoring body along with copies of its registration
certificate and bye-laws duly certified by its competent authority;
the information regarding financial resources of the sponsoring body
along with audited accounts for the past three years;
the name and location of the proposed University;
the objectives of the University;
the availability of land and details of buildings and infrastructure
facilities, if the same already exists, and details of land, building and
other infrastructure proposed to be owned or created;
(I) the nature and the type of programmes of study and research proposed to
be undertaken by the University and their relevance to the development
goals and employment needs of the State and phasing of such
programmes over the first five years with course-wise enrolment targets;
details of proposed academic facilities including teaching and non-
teaching staff;
facilities, courses of study and research proposed to be started;
the experience and expertise in the concerned disciplines available with
the sponsoring body;
the details of plans for campus development such as construction of
buildings, development of structural amenities and infrastructure
facilities and procurement of equipment etc. tp be undertaken before the
University starts functioning and phased programmes for the first five
years;
the phased outlays of capital expenditure proposed for the next five
years;
(1) the sources of funds along with the scheme for mobilizing resources, the
cost of capital thereto and the manner of repayment to Such sources;
the system proposed to be 'followed for selecting students for admission
to the courses of study at the University in the first year of operation;
the system proposed to be followed for appointment of teachers and
other employees in the University;
whether the University proposes to undertake some programmes related
to local needs. If so, the nature of specialized teaching, training or
research Activities to be undertaken by the University so as to fulfil this
objective;
(n) whether the University proposes to start some programmes for the
benefit of farmers, women and local industries, if so, details thereof may
be given;
191 RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

32 WWWW,6W. 2019
(r) to undertake neither to be involved nor to permit anyone to cause or
promote anti-national activities inside the campus of the University or ’
under the name of the University. In case of any such activity found in
the University, it shall be considered as a major violation of the
conditions of setting up the University and the (jovemment may take
action according to the provisions under this Act or any law for the time
being in force.
Submission of 4. (1) An application containing the proposal and the project report to establish
gmfifxxm on a University shall be made by the sponsoring body to the State Government along with
new UnivefSiW application fee as may be fixed by the State Government from time to time. i
(2) The project report must contain the following particulars, namely:-
(a) the details of the sponsoring body along with copies of its registration
certificate and bye-laws duly certified by its competent authority;
(b) the information regarding financial resources of- the sponsoring body
along with audited accounts for the past three years;
(c) . the name and location of the proposed University; - ,
(d) the objectives of the University;
(e) the availability of land and details of buildings and infrastructure
facilities, if the same already exists, and details of land, building and \
other infrastructure proposed to be owned or created;
(0 the nature and the type of programmes of study and research proposed to
be undertaken by the University and their relevance to the development
goals and employment needs of the State and phasing of such
programmes over the first five years with course-wise enrolment targets;
(g) details of proposed academic facilities including teaching and non-
teaching staff; .
(h) facilities, courses of study and research proposed to be started;
(i) the experience and expertise in the concerned disciplines available with
the sponsoring body;
(j)' the details of plans for campus development such as construction of
buildings, development V of structural amenities and infrastructure
facilities and procurement of equipment etc. to be undertaken before the
University starts functioning and phased programmes for the first five
yearS; .
'(k) the phased outlays of capital expenditure proposed for the next five
years; i
(l) the sources of funds along with the scheme for mobilizing resources, the ,
cost of capital thereto and the manner of repayment to such sources;
(m) the system proposed to be ‘followed for selecting students for admission
to the courses of study at the University in the first year of operation;
(n) the system proposed to be followed for appointment of teachers and
other employees in the University; '
(0) whether the University proposes to undertake some programmes related
to local needs. If so, the nature of specialized teaching, training or
research Activities to be undertaken by the University so as to fulfil this
objective; '
(p) whether the University proposes to start some programmes for the
benefit of farmers, women and local industries, if so, details thereof may
be given; ‘
l9l_RPH_Data 4 Vidhaika Folder ( Adhiniyam_20l9)
ittlX• A-a-2T 31WflETRuf quid, 6 3111W1, 2019 33
details of play grounds and other facilities available or proposed to be
created for games and sports and extra curricular activities like
National Cadet Corps, National Service Scheme, Rover and Rangers
etc;
the arrangements proposed to be made for academic excellence, if any;
such other details as the sponsoring body may like to give;
such other details as may be decided by the State Government from
time to time.
5. (1) The Higher Education Department of the State Government on receipt of
the proposal along with the project report for establishment of a University shall
constitute a committee consisting of
(a) one Vice-Chancellor of any of the State Universities established under
the Uttar Pradesh State Universities Act, 1973;
()) one Professor @f a State University nominated by the State
Government;
one officer to the Government of Uttar Pradesh not below the rank of
Joint Secretary;
one Officer of Finance and Account Services of Uttar Pradesh not
below the rank of Joint Director;
one officer nominated by the District Magistrate of the District
concerned not below the rank of Sub-divisional Magistrate;
one Registrar of a University established under the Uttar Pradesh State
Universities Act, 1973 to be nominated by the State Government.
The committee shall consider the proposal and the project report together
with the financial soundness and assets of the sponsoring body and its overall ability to
set up the proposed University.
The committee, while considering the proposal and the project report may
call for such other information from the sponsoring body as it thinks proper for the
purpose. (4) The committee shall submit its report.to the Higher Education Department
of the State Government within a period of three months from the date of its
constitution:
Provided that if the Committee could not submit its report within the said three
months period for any sufficient reasons to be recorded in writing, it may submit its
report to the Higher Education Department of the State Government within further one
month or such period as may be permitted by the State Government:
Provided further that the inspections carried out by any committee constituted
under the orders of the State Government before the commencement of this Act shall be
deemed to be the inspection carried out by the evaluation committee constituted under
sub-section (1) above.
6. (1) After the receipt of the report of the committee constituted under
section 5, if the State Government is satisfied that it is proper to establish the University,
it may issue a 'Letter of Intent'.
The sponsoring body shall fulfill the requirements and conditions specified in
section 3 and shall submit to the State Government compliance report thereof supported
by an affidavit within a maximum period of two years from the date of issue of the letter
of intent.
If the sponsoring body fails to comply with the provisions of section 3, the
State Government shall have power to withdraw the letter of intent issued to the
sponsoring body.
Evaluation of
proposals by
evaluation
committee
Issuance of letter
of intent and
submission of
compliance
report by
sponsoring body
191 RPH_Data 4 Vidhailca Folder (Adhiniyam_2019)

WWWW,SW,ZO19
(q) details of play grounds and other facilities available or proposed to be
created for games and sports and extra curricular activities like
National Cadet Corps, National Service Scheme, Rover and Rangers
etc; .
(r) the arrangements proposed to be made for academic excellence, if any;
(5) such other details as the sponsoring body may like to give;
(t) such other details as may be decided by the State Government from
time to time.
5. (l) The Higher Education Department of the State Government on receipt of
the proposal along with the project report for establishment of a University shall
constitute a committee consisting of: —
(a) one Vice-Chancellor of any of the State Universities established under
the Uttar Pradesh State Universities Act, 1973;
(b) one Professor (of a State University nominated by the State
Government;
(c). one officer to the Government of Uttar Pradesh not below the rank of
Joint Secretary; .
(d) one Officer of Finance and Account Services of Uttar Pradesh not
below the rank of Joint Director;
(e) one offiCer nominated by the District Magistrate of the District
concemed not below the rank of Sub-divisional Magistrate;
(0 one Registrar of a University established under the Uttar Pradesh State
Universities Act, 1973 to be nominated by the State Government.
(2) The committee shall consider the proposal and the project report together
with the financial soundness and assets of the sponsoring body and its overall ability to
set up the proposed University.
(3) The committee, while considering the proposal and the project report may
call for such other information fiom the sponsoring body as it thinks proper for the
purpose. ,
(4) The committee shall submit its reportto the Higher Education Department
of the State Government within a period of three months from the date of its
constitution:
Provided that if the Committee could not submit its report within the said three
months period for any sufficient reasons to be recorded in writing, it may submit its
report to the Higher Education Department of the State Government within further one
month or such period as may be permitted by the State Government:
Provided further that the inspections carried out by any committee constituted
under the orders of the State Government before the commencement of this Act shall be
deemed to be the inspection carried out by the evaluation committee constituted under
sub- section (1) above. -
6. (1) After the receipt of the report of the committee constituted under
section 5, if the State Government is satrst' ed that it is proper to establish the University,
it may issue a 'Letter of Intent'.
(2) The sponsoring body shall fulfill the requirements and conditions specified in
section 3 and shall submit to the State Government compliance report thereof supported
by an affidavit within a maximum period of two years from the date of issue of the letter
of intent.
(3) If the sponsoring body fails to comply with the provisions of section 3, the
State Govemmenf shall have power to withdraw the letter of intent issued to the
sponsoring body.
l9lARPH_Data 4 Vidhaika Folder (Adhiniyam_2019)
33
Evaluation of
proposals by
evaluation
committee
Issuance of letter
of intent and
submission of
compliance
report by
sponsoring body
34
•Icck. SItti 3M11117111 qui( 6 Wrer, 2019
Establishment or
incorporation of a
new University
Powers of the
University
7. (1) The State Government, if satisfied, after considering the compliance
report submitted under section 3 that the sponsoring body has complied with the
provisions of sub-section (1) of section 6, may, by a notification published in the
Gazette permit the University to operate with such name and location as per the letter
of Intent.
Names of the new Universities to be established under this Act shall be
included in Schedule-2 by amending this Act.
After its establishment, the name of the newly established University shall
be mentioned by the State Government at the next serial number below the last
University mentioned in the Scheduled-2 appended this Act.
Every University established or incorporated under this Act shall be a body
corporate.
8. On the commencement of this Act the existing Universities enumerated in
Schedule-I shall stand incorporated under this Act.
9. The University shall not admit any college or institution to the privilege of
affiliation.
10. The objects of the University shall be to disseminate and ensure
advancement of knowledge and skill for providing instructional, research and extension
facilities in such branches of learning as it may deem fit and the University shall
endeavour to provide to students and teachers the necessary atmosphere and facilities
for the promotion of:-
innovations in education, leading to restructuring of courses, new
methods of teaching, training and learning including online learning,
blended learning, continuing education and such other modes and
integrated and wholesome development of personality;
studies in various disciplines;
interdisciplinary studies;
national integration, patriotism, secularism, social equity and
inculcation of international understanding and ethics.
11. Subject to the guidelines and norms as prescribed by the Regulatory
Bodies and the State Government from time to time the University shall have the
powers, -
(a)
Incorporation of the
existing Universities
Prohibition for
affiliation
Objects of the
University
to provide for instruction in such branches of learning as the
University may, from time to time, determine and to make provisions
for research and for the advancement and dissemination of knowledge
and skills;
to provide for instruction in such branches of learning as the
University may think fit and to make provisions for research and for
the advancement and dissemination of knowledge;
to honour educational stalwarts and persons of academic eminence
with designation of professor Emeritus;
to grant, subject to such conditions as the University may determine,
diplomas or certificates to, and confer degrees or other academic
distinctions on the basis of examinations, evaluation or any other
method of testing of persons, and to withdraw any such diplomas,
certificates, degrees or other academic distinctions for good and
sufficient cause;
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

34
Establishment or
incorporation of a
new University
Incorporation of the
existing Universities
Prohibition for
affiliation
Objects of the
University
Powers of the
University
l9l_RPH_Data 4 Vidhaika Folder (Adhiniyam_20l 9)
WWWW6W 2019
7. (l) The State Government, if satisfied, afier considering the compliance
report submitted under section 3 that the sponsoring body has complied with the
provisions of sub-section (1) of section 6, may, by a notification published in the
Gazette permit the University to operate with such name and location as per the letter
of Intent. ,4
(2) Names of the new Universities to be established under this Act shall be
included in Schedule-2 by amending this Act. '
(3) Alter its establishment, the name of the newly established University shall
be mentioned by the State Govermnent at the next serial number below the last
University mentioned in the Scheduled—2 appended this Act.
(4) Every University established or incorporated under this Act shall be a body
corporate. ’
8 On the commencement of this Act the existing Universities enumerated 1n
Schedule-l shall stand incorporated under this Act.
9. The University shall not admit any college or institution to the privilege of
affiliation.
10. The objects of the University shall be to disseminate and ensure
advancement of knowledge and skill for providing instructional, research and extension
facilities in such branches of learning as it may deem fit and the University shall
endeavour to provide to students and teachers the necessary atmosphere and facilities
I for the promotion of: -
(a) innovations in education, leading to restructuring of courses, new
methods of teaching, training and learning including online learning,
blended learning, continuing education and such other modes and
integrated and wholesome development of personality;
(b) studies in various disciplines;
(c) interdisciplinary studies;
(d) national integration, patriotism, secularism social equity and
inculcation of international understanding and ethics.
11. Subject to the guidelines and norms as prescribed by the Regulatory
Bodies and the State Government from time to time the University shall have the
powers, - ‘ ' .
(a) to provide for instruction in such branches of learning as the
University may, from time to time, determine and to make provisions
for research and for the advancement and dissemination of knowledge
and skills;
(b) to provide for instruction in such branches of learning as the
University may think fit and to make provisions for research and for
the advancement and dissemination of knowledge;
(c) to honour educational stalwarts and persons of academic eminence
with designation of professor Emeritus;
(d) to grant, subject to such conditions as the University may determine,
diplomas or certificates to, and confer degrees or other academic
distinctions on the basis of examinations, evaluation or any other
method of testing of persons, and to withdraw any such diplomas,
certificates, degrees or other academic distinctions for good and
sufficient cause;
(e) to confer honorary degrees or other distinctions with prior approval of the
State Government;
(f) to institute as per norms of Regulatory Authorities and State Government
Directorships, Professorships, Associate Professorships, Assistant
Professorships, and other teaching or academic posts required by the
University and to make appointments for the same;
to create administrative, ministerial and other posts and to make
appointments thereto;
to appoint/engage persons of eminence, working in any other University or
organization permanently or for a specified period;
to co-operate, collaborate or associate with any other University or
Authority or Institution in India and abroad in such manner and for such
purpose as the University may determine;
to establish and maintain schools, centres, specialized laboratories in other
units for research and instructions as are in the opinion of the University,
necessary for the furtherance of its objects;
to institute and award fellowships, scholarships, studentships, medals and
prizes;
to establish, maintain and supervise residences, hostels and promote the
health and general welfare Activities for students and staff;
to make provisions for research and consultancy, and for that purpose to
enter into such arrangements with other institutions or bodies as the
University may deem necessary;
to establish a faculty, a department, a centre, or school, as the case may
be, in accordance with the Act and Statutes;
to determine standards in accordance with the State Government and other
Regulatory Bodies for admissions into the University, which may include
examination, evaluation or any other method of testing to ensure quality;
to demand and receive payment of fees and other charges;
to make special arrangements in respect of women and other
disadvantaged students as the University may consider desirable;
to regulate and enforce discipline among the employees and students of the
University and take such disciplinary measures in this regards as may be
deemed necessary by the University;
to make arrangements for promoting the health and general welfare of the
employees of the University;
to receive donations and to acquire, hold and manage any property,
movable or immovable for the welfare of the University;
to ensure that no immovable property shall be disposed off or rights or title
therein parted with or any liability created thereon, by any of the officers
or authorities of the University, except after prior approval of the State
Government;
to appoint either on contract or otherwise, visiting professors emeritus
professors, consultants, fellows, scholars, artists, course directors and such
other persons who may contribute to the advancement of the objects of the
University;
to organize and to undertake extramural studies and extension service; and
to do all such other acts and things as may be necessary, incidental or
conducive to the attainment of all or any of the objects of the University.
\icvl 31711ITRuT Rif , 6 3111RI, 2019 35
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

'Wmmmm,sm.2o19 35
(e) to confer honorary degrees or other distinctions with prior approval of the
State Government;
(f) to institute as per norms of Regulatory Authorities and State Government
Directorships, Professorships, Associate Professorships, Assistant
Professorships, and other teaching or academic posts required by the
University and to make appointments for the same;
(g) to create administrative, ministerial and other posts and to make
' appointments thereto;
(11) ' ’ to appoint/engage persons of eminence, working in any other University or
organization permanently or for a specified period;
(i) to co-operate, collaborate or associate with any other University or
Authority or Institution in India and abroad in such manner and for such
purpose as the University may determine;
0) . to establish and maintain schools, centres, specialized laboratories in other
units for research and instructions as are in the opinion of the University,
necessary for the furtherance of its objects; '
(k) to institute and award fellowships, scholarships, studentships, medals and
prizes;
r (l) to establish, maintain and supervise residences, hostels and promote the
health and general welfare Activities for students and staff;
(m) to make provisions for research and consultancy, and for that purpose to
enter into such arrangements with other institutions or bodies as the
University may deem necessary; ‘
(n) to establish a faculty, a department, a centre, or school, as the case may
be, in accordance with the Act and Statutes;
(o) to determine standards in accordance with the State Government and other
Regulatory Bodies for admissions into the University, which may include
examination, evaluation or any other method of testing to ensure quality;
(p) to demand and receive paymentof fees and other charges;
(q) to make special arrangements in respect of women and other
disadvantaged students as the University may Consider desirable;
(r) to regulate and enforce discipline among the employees and students of the
University andtake such disciplinary measures in this regards as may be
deemed necessary by the University;
(5) to make arrangements for promoting the health and general welfare of the
employees of the University; ‘ I
(t) to receive donations and to acquire, hold and manage any property,
movable or immovable for the welfare of the University;
(u) to ensure that no immovable property shall be disposed ofl" or rights or title
therein parted with or any liability created thereon, by any of the officers
or authorities of the University; except afler prior approval of the State
Government;
(v) to appoint either on contract or otherwise, visiting professors emeritus
professors, consultants, fellows, scholars, artists, course directors and such'
other persons who may contribute to the advancement of the objects of the
University;
(w) to organize and to undertake extramural studies and extension service; and
(x) to do all such other acts and things as may be necessary, incidental or
conducive to the attainment of all or any of the objects of the University.
l9l_RPH_Data 4 Vidhaika Folder (Adhiniyam_20]9)
36 \lc-ci'( %i1 aistFuT 4i d, 6 3111-el, 2019
12. (1) Admissions to the different academic programmes shall be made in
accordance with the norms to be determined by the admissions committee in
accordance with the provisions of the Act, the Statutes, Ordinances made thereunder.
The University shall ensure that the academic standards of the courses
offered by the University are in accordance with the guidelines of the Regulatory
Bodies.
The teacher-student ratio shall be in accordance with the guidelines of the
Regulatory Bodies.
13. The University shall be open to persons of all sex and of whatever race,
creed, caste or class, and it shall not be lawful for the University to adopt to impose on
any person any test whatsoever of his religious belief or profession in order to entitle
him to be admitted therein as an officer, a teacher, staff member, student, or to hold
any office therein or to graduate thereat:
Provided that reservation in the posts and recruitment of the employees
and reservation of seats for admission in any course of study in the University for the
students belonging to the Scheduled Castes, Scheduled Tribes, Other Backward
Classes and Economically Weaker Sections of General Category of citizens shall be
regulated by the orders and guidelines of the State Government issued from time to
time.
Officers of the 14. The following shall be the Officers of the University:-
University
The Chancellor or
the President
the Chancellor or the President;
the Pro-Chancellor or Vice-President;
the Vice-Chancellor;
the Pro-Vice-Chancellor;
the Registrar;
the Dean of Faculty;
the Dean of Students' Welfare;
the Director;
the Controller of Examinations;
the Chief Proctor;
the Finance Officer; and
such other Officers as may be declared by the Statutes to be the officers
of the University.
15. (1) The Chancellor/President shall be appointed by the Governing Body
for a period of five years by following such procedure and on such terms and
conditions as may be prescribed.
The Chancellor/ President shall be the head of the University.
The Chancellor/President shall preside over the meetings of the
Governing Body and convocation of the University.
If, at any time, upon representation made or otherwise, and after making
such inquiry, as may be deemed necessary, the situation so warrants that the
continuance of the Chancellor/President is not in the interest of the University,
Governing Body, may, by majority decision ask the Chancellor/ President by an order,
in writing stating the reasons therefor, to relinquish his office before expiration of his
tenure from such date as may be specified in the order. In such case the
Pro-Chancellor/Vice-President shall preside over the meeting of the Governing Body:
Provided that before taking an action under this sub-section, the
Chancellor/President shall be given an opportunity of being heard.
I91_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)
Admission and
Standards
University open to
all classes and
creeds

36
Admission and
Standards
University open to
all classes and
creeds
Officers of the
University
The Chancellor or
thePresident
Bodies.
time.
WWWW, same, 2019
12. (l) Admissions to the different academic programmes shall be made in
accordance with the norms to be determined by the admissions committee in
accordance with the provisions of the Act, the Statutes, Ordinances made thereunder.
(2) The University shall ensure that the academic standards of the courses
offered by the University are in accordance with the guidelines of the Regulatory
(3) The teacher-student ratio shall be inaccordance with the guidelines of the
Regulatory Bodies.
13. The University shall be open to persons of all sex and of whatever race,
creed, caste or class, and it shall not be lawful for the University to adopt to impose on
any person any test Whatsoever of his religious belief or profession 1n order to entitle
him to be admitted therein as an officer, a teacher, staff member, student, or to hold
any office therein or to graduate thereat: .
Provided that reservation in the posts and recruitment of the employees
and reservation of seats for admission in any course of study in the University for the
students belonging to the Scheduled Castes, Scheduled Tribes, Other Backward
Classes and Economically Weaker Sections of General Category of citizens shall be
regulated by the orders and guidelines of the State Government issued fiom time to
14..The following shall be the Officers of the University:-
(1) the Chancellor or the Piesident;
(2) the Pro-Chancellor or Vice-President; '
(3) the Vice-Chancellor; I
(4) the Pro-Vice-Chancellor;
(5) the Registrar;
(6) the Dean of Faculty;
(7) the Dean of Students' Welfare;
(8) the Director;
(9) the Controller of Examinations;
(10) the Chief Proctor; ,
(11) the Finance Officer; and ‘ "
(12) such other Officers as may be declared by the Statutes to be the officers ‘
of the University.
15. (1) The Chancellor/President shall be appointed by the Governing Body —'
for a period of five years by following such procedure and on such terms and 2
conditions as may be prescribed
(2) The Chancellor/ President shall be the head of the University.
(3) The Chancellor/President shall preside over the meetings of the
Governing Body and convocation of the University.
(4) If, at any time, upon representation made or otherwise, and after making '
such inquiry, as may be deemed necessary, the situation so warrants that the {
continuance of the Chancellor/President is not in the interest of the University,
GoVeming Body, may, by majority decision ask the Chancellor/ President by an order\
in writing stating the reasons therefor, to relinquish his office before expiration of his
tenure from such date as may be specified in the order. In such case the
Pro-ChancellorNice-President shall preside over the meeting of the Governing Body:
Provided that before taking an action under this sub-section, the.
Chancellor/President shall be given an opportunity of being heard. . I
l9l_RPHVData 4 Vidhaika Fold (Adhiniyamg20l9)
\deer( 3MTETRuT , 6 &WWI, 2019 37
(5) The Chancellor/the President shall have the following powers, namely:-
to call for any information or record of the University;
to appoint the Vice-Chancellor under sub-section (1) of section 17
of this Act ;
to remove the Vice-Chancellor in accordance with the provisions of
this Act and Statutes made thereunder;
such other powers as may be prescribed.
(6) The Chancellor/President shall draw salary not exceeding double the amount
of salary of the Pro-Chancellor/the Vice-President of the University.
16. (1) The Pro-Chancellor/Vice-President shall be appointed by the
Chancellor/President with the approval of the Governing Body for a period of five years.
The Pro-Chancellor/Vice-President shall assist the Chancellor, President,
respectively in discharging his/her duties and preside at the convocation in his/her
absence.
The Pro-ChancellorNice-President may in writing under his hand addressed
to the Chancellor/President resign from his office.
(4) If, at any time, upon representation made or otherwise, and after making such
inquiry, as may be deemed necessary, the situation so warrants that the continuance of
the Pro-Chancellor/Vice-President is not in the interest of the University, the
Pro-Chancellor/Vice-President with the prior approval of the Governing Body, may, by
an order in writing stating the reasons therefor, ask the Pro-Chancellor/Vice-President to
relinquish his office before expiration of his tenure from such date as may be specified in
the order:
The Pro-
Chancellor or
Vice-President
Provided that before taking an action under this sub-section, the
Pro-Chancellor/Vice-President shall be given an opportunity of being heard.
The Pro-Chancellor/Vice-President shall draw salary which shall be less than
that of the Chancellor/President of the University.
17. (1) The Vice-Chancellor shall be appointed by the Chancellor/President with The Vice-
prior approval of the Governing Body: Chancellor
Provided that a Vice-Chancellor shall be eligible for reappointment after the
expiry his/her term.
The Vice-Chancellor shall hold office for a period of five years or until he/she
attains the age of seventy years whichever is earlier.
If, at any time, upon representation made or otherwise, and after making such
inquiry, as may be deemed necessary, the situation so warrants that the continuance of
the Vice-Chancellor is not in the interest of the University, the Governing Body may, by
an order in writing stating the reasons therefor, ask the Vice-Chancellor to relinquish his
office from such date as may be specified in the order:
Provided that before taking an action under this sub-section, the Vice-Chancellor
shall be given an opportunity of being heard.
The Vice-Chancellor shall be the principal executive and academic officer of
the University and shall exercise general superintendence and control over the affairs
of the University and shall be the chairperson of the Executive Council and execute the
decisions of the Executive Council and other competent bodies and the State
Government made under the provisions of the Act and the Statutes, Ordinances and
Regulations made thereunder.
19I_RP1l_Dala 4 Vidhaika Folder (Adbiniyam_2019)

WWWW,6W, 2019 ' 37
(5) The Chancellor/the President shall have the following powers, namely:-
(a) to call for any information or record of the University;
(b) to appoint the Vice-Chancellor under sub-section (1) of section 17
of this Act;
(c) to remove the Vice-Chancellor in accordance with the provisions of ‘
this Act and Statutes made thereunder;
(d) such other powers as may be prescribed.
(6) The Chancellor/President shall draw salary not exceeding double the amount
of salary of the Pro- Chancellor/the Vice-President of the University.
16. (l) The Pro-ChancellorNice—President shall be appointed by the ThePro-
Chancellor/President with the approval of the Goveming Body for a period of five years. Chmwum‘"
Vice-President
(2) The Pro-ChancellorN1ce-President shall assist the Chancellor, President
respectively in discharging his/her duties and preside at the convocation in his/her
absence.
(3) The Pro-ChancellorNice—Presiderit may in writing under his hand addressed
to the Chancellor/President resign from his office. '
a (4) If, at any time, upon representation made or otherwise, and alter making such
inquiry, as may be deemed necessary, the situation so warrants that the continuance of '
the Pro-Chancellor/Vice—President is not in the interest of the University, the
Pro-ChancellorNice-President with the prior approval of the Governing Body, may, by
an order 1n writing stating the reasons therefor, ask the Pro-ChancellorN1ce-Presrdent to
relinquish his office before expiration of his tenure fiom such date as may be specified 1n
the order:
Provided that before taking an action under this sub-section, the
Pro-ChancellorNice-President shall be given an opportunity of being heard.
(5) The Pro-Chancellor/Vice-President shall draw salary which shall be less than
that of the Chancellor/President of the University.
17. (l) The Vice-Chancellor shall be appointed by the Chancellor/President with The Vice-
prior approval of the Governing Body. Chancellor
Provided that a Vice— Chancellor shall be eligible for reappointment afier the
expiry his/her term.
i (2) The Vice-Chancellor shall hold office for a period of five years or until he/she
attains the age of seventy years whichever is earlier -
(3) If, at any time, upon representation made or otherwise, and alter making such
inquiry, as may be deemed necessary, the situation so warrants that the continuance of
the Vice-Chancellor 15 not in the interest of the University, the Governing Body may, by
an order in writing stating the reasons therefOr, ask the Vice-Chancellor to relinquish his
office from. such date as may be specified in the order: ‘
_ Provided that before taking an action under this sub-section, the Vice-Chancellor
shall be given an opportunity of being heard.
(4) The Vice-Chancellor shall be the principal executive and academic officer of
the University and shall exercise general superintendence and control over the affairs
of the University and shall be the chairperson of the Executive Council and execute the
decisions of the Executive Council and other competent bodies and the State
Government made under the provisions of the Act and the Statutes, Ordinances and
Regulations made thereunder. '
l9l_RPH_Dala 4 Vidhaika Folder (Adhiniyam_20]9)
38 k3c-c-1,C It4T 3171TtITPT . Ivi , 6 31-TRU, 2019
The Vice-Chancellor shall preside over the convocation of the University in
the absence of the Chancellor/President and the Pro-ChancellorNice-President.
If in the opinion of the Vice-Chancellor, it is necessary to take immediate
action on any matter for which powers are conferred on any other authority by or under
this Act, he may take such action as he deems necessary and shall at the earliest
opportunity thereafter report his action to such officer or authority as would have in the
ordinary course dealt with the matter within a period of thirty days:
Provided that if in the opinion of the concerned officer or authority such action
should not have been taken by the Vice- Chancellor, then such case shall be referred to
the Chancellor/President, whose decision thereon shall be final.
The Vice-Chancellor shall exercise such powers and perform such duties as
may be provided under this Act and the Statutes, Ordinances and Regulations made
thereunder.
The Pro-Vice-
18. (1) The Pro-Vice- Chancellor shall be appointed by the Vice- Chancellor in
Chancellor such manner and shall exercise such powers and perform such functions as may be
prescribed by the Statutes and provided in the Ordinances and regulations.
The Pro-Vice Chancellor appointed under sub-section (1) shall discharge his
duties in addition to his duties as a Professor.
The Pro-Vice-Chancellor shall assist the Vice-Chancellor in discharging day
to day duties as and when required by the Vice- Chancellor.
The Pro-Vice-Chancellor shall get honorarium of such amount as may be
determined by the Sponsoring Body.
The Registrar
19. (1) The qualifications, term of office, conditions of service and procedure of
appointment of the Registrar shall be such as may be prescribed.
The Registrar shall have the power to authenticate records on behalf of the
University.
The Registrar shall be responsible for the due custody of records and the
common seal of the University. He shall be the a-officio Secretary of the Governing
Body, the Executive Council, the Academic Council and the Admissions Committee and
every Selection Committee for appointment of teachers of the University, and shall be
bound to place before these authorities all such information as may be necessary for
transaction of their business. He shall also perform such other duties as may be
prescribed by the Statutes, Ordinances and Regulations, and required, from time to time,
by the Executive Council or the Vice-Chancellor but he shall not by virtue of this
sub-section, be entitled to vote.
Dean of Faculty
20. Every Dean shall be appointed in such manner and shall exercise such
powers and perform such functions as may be prescribed.
Finance Officer
21. (I) The Finance Officer shall be appointed in such manner and shall exercise
such powers and perform such functions as may be prescribed.
(2) The Finance Officer shall be the a-officio Secretary of the Finance
Committee.
Other Officers
22. The manner of appointment and powers and duties of the other officers of the
University including the Dean of Students' Welfare, Controller of Examinations and
Chief Proctor shall be such as may be prescribed. •
Authorities of the
23. The following shall be the Authorities of the University:-
University
the Governing Body ;
the Executive Council;
the Academic Council;
19I_RPH_Data 4 Vidhaika Folder (A4hiniyam_2019)

38
The Pro-Vice-
Chancellor
The Registrar
Dean of Faculty
Finance Officer
Other Officers
Authorities of the
University
WWWW.GW,ZO19
(5) The Vice-Chancellor shall preside over the convocation of the University in
the absence of the Chancellor/President and the Pro—Chancellor/Vice-President.
(6) If in the opinion of the Vice-Chancellor, it is necessary to take immediate
action on any matter for which powers are conferred on any other authority by or under
this Act, he may take such action as he ”deems necessary and shall at the earliest '
opportunity thereafier report his action to such officer or authority as would have in the
ordinary course dealt with the matter within a period of thirty days :
Provided that if in the opinion of the concerned officer or authority such action
should not have been taken by the Vice- Chancellor, then such case shall be referred to
the Chancellor/President, whose decision thereon shall befinal.
(7) The Vice-Chancellor shall exercise such powers and perform such duties as '
may be provided under this Act and the Statutes, Ordinances and Regulations made
thereunder. '
18. (1) The Pro-Vice- Chancellor shall be appointed by the Vice- Chancellor in
such manner and shall exercise such powers and perform such functions as may be
prescribed by the Statutes and provided in the Ordinances and regulations. '
(2) The Pro-Vice Chancellor appointed under sub-section (1) shall discharge his
duties in addition to his duties as a Professor.
(3) The Pro-Vice-Chancellor shall assist the Vice-Chancellor in discharging day
to day duties as and when required by the Vice— Chancellor.
(4) The Pro-Vice-Chancellor shall get honorarium of such amount as may be
determined by the Sponsoring Body.
_ . l9. (1) The qualifications, term of office, conditions of service and procedure of
appointment of the Registrar shall be such as may be prescribed
(2) The Registrar shall have the power to authenticate records on behalf of the
University.
(3) The Registrar shall be responsible for the due custody of records and the
common seal of the University. He shall be the ex-oflicio Secretary of the Governing
Body, the Executive Council, the Academic Council and the Admissions Committee and
every Selection Committee for appointment of teachers of the University, and shall be
bound to place before these authorities all such information as may be necessary for
transaction of their business. He shall also perform such other duties as may be
prescribed by the Statutes, Ordinances and Regulations, and required, from time to time,
by the Executive Council or the Vice-Chancellor but he shall not by virtue of this
sub-section, be entitled to vote.
20. Every Dean shall be appointed in such manner and shall exercise such
powers and perform such functions as may be prescribed.
21. (l) The Finance Officer shall be appointed in such manner and shall exercise
such powers and perform such functions as may be prescribed. '
(2) The Finance Officer shall be the ex—oflicio Secremry of the Finance
Committee. I
22. The manner of appointment and powers and duties of the other officers of the
University including the Dean of Students' Welfare, Controller of Examinations and
Chief Proctor shall be such as may be prescribed. .
23. The following shall be the Authorities of the University:-
(1) the Governing Body ;
(2) the Executive Council ;
(3) the Academic Council;
191_an_nm 4 van-m Folder (ngow)
0-4141 31WITE/1T8 IluiC 6 3411i?t, 2019 39
the Finance Committee;
the Planning Board;
the Board of Faculties;
the Board of Studies;
the Admissions Committee;
the Examinations Committee; and
such other authorities as may be declared by the Statutes to be the
authorities of the University.
24. (1) The constitution of the Governing Body and the term of office of its
members shall be such as may be prescribed.
The Governing Body shall meet once a year on the date to be fixed by the
Chancellor/President and such meeting shall be called the annual meeting of the
Governing Body:
Provided that the Chancellor/President may, whenever he thinks fit, and
shall, upon a requisition in writing signed by not less than one fourth of the total
membership of the Governing Body, convene a special meeting of the Governing
Body.
Subject to provisions of this Act, the Governing Body shall Act as an
advisory Body of the University and have the following powers and functions,
namely:-
to review from time to time, the broad policies and programmes of
the University and suggest measures for the working, improvement
and development of the University;
to consider and pass resolutions on the Annual Report and Annual
accounts of the University and Audit Report of such accounts and
furnish their views to the Executive Council;
to advise the President in respect of any matter which may be
referred to it for advice;
to perform such other functions as may be prescribed.
25. (1) The Executive Council shall be the principal executive body of the
University.
The meeting of the Executive Council may be convened as may be
prescribed.
The administration, management and control of the University and the
income thereof shall be vested with the Executive Council which shall control and
administer the property and funds of the University.
The Executive Council, subject to the provisions of this Act, have the
following powers and duties:—
to hold and control the property and funds of the University;
to acquire any movable or immovable property on behalf of the
University;
to make, amend or repeal Statutes and Ordinances;
to administer any funds placed at the disposal of the University
for specific purposes;
to approve the budget of the University;
to institute scholarships, fellowships, bursaries, medals and other
rewards in accordance with the Statutes and Ordinances;
to appoint Registrar, officers, teachers and employees of the
University and define the duties and conditions of their secvice;
The Governing
Body
The Executive
Council
19I_RPH_Data 4 Vidhaika Folder (Adhiniyare_2019)

WWWW,6W,ZO19 ' ' 39
(4) the Finance Committee ;
(5)’ the Planning Board; ‘
(6) the Board of Faculties; .
(7) the Board of Studies;
(8) the Admissions Committee;
(9) the Examinations Committee; and «
(10) such other authorities as may be declared by the Statutes to be the
authorities of the University.
24. (l) The constitution of the Governing Body and the term of office of its The Governing
members shall be such as may be prescribed. 3“”
(2) The Governing Body shall meet once a year on the date to be fixed by the
Chancellor/President and such meeting shall be called the annual meeting of the
Governing Body:
Provided that the Chancellor/President may, whenever he thinks fit, and
shall, upon a requisition in writing signed by not less than one fourth of the total
( membership of the Governing Body, convene a special meeting of the Governing
Body. .
(3) Subject to provisions of this Act, the Governing Body shall Act as an'
t advisory Body of the University and have the following powers and fimctions,
namely. -
(a) to review from timeto time, the broad policies and programmes of
' the University and suggest measures for the working, improvement
. and development of the University;
(b) to consider and pass resolutions on the Annual Report and Annual
accounts of the University and Audit Report of such accOunts and
fumish their views to the Executive Council;
(c) to advisethe President in respect of any matter which may be
referred to it for advice;
(d) to perform such other functions as may be prescribed.
25. (1) The Executive COuncil shall be the principal executive body of the he Exec-Hive
University Council
(2) The meeting of the Executive Council may be convened as may be
prescribed.
(3) The administration, management and control of the University and the
‘ income thereof shall be vested with the Executive Council which shall control and
administer the property and funds of the University.
(4) The Executive Council, subject to the provisions of this Act, have the
‘ following powers and duties:—
(i) to hold and control the property and funds of the University;
(ii) to acquire any movable or immovable property on behalf of the
University; ' V
(iii) to make, amend or repeal Statutes and Ordinances;
(iv) to administer any funds placed at the disposal of the University
, for specific purposes;
(v) to approve the budget of the University;
(vi) to institute scholarships, fellowships, bursaries, medals and other
rewards in accordance with the Statutes and Ordinances;
(vii) to appoint Registrant ofiicers, teachers and employees of the
' University and define the duties and conditions of their service;
‘ ~
l9l_RPH_Dm 4 Vitihaikn Folder (Adhiniyum_20|9)
40 ‘3cM ia1 31-fiTURuf , 6 aTIRTI, 2019
to fix the honorarium, emoluments, traveling and other allowances
of the examiners;
to direct the form and use of the common seal of the University;
to regulate and enforce discipline among members of the teaching,
administrative and other staff of the University in accordance with
the Statutes and Ordinances;
to manage and regulate the finances, accounts, investments,
property and all other administrative affairs of the University;
to invest any money belonging to the University including
endowed property;
to provide the buildings, premises, -furniture, equipments,
apparatus and other means needed for carrying on the work of the
University;
to enter into, vary, carry out, and cancel contract on behalf of the
University;
to regulate• and determine all other matters concerning the
University in accordance with this Act, the Statutes, the
Ordinances and the Regulations.
(5) Every decision of the Executive Council shall be informed by the reasons
therefor.
The Academic
Council
(6) The Vice-Chancellor shall be the Chairperson of the Executive Council,
which shall consist of the following other members, namely :—
. three members to be nominated by the Governing Body;
two eminent educationists nominated by the President;
one officer of the State Government not below the rank of Joint
Secretary to the Government of Uttar Pradesh;
one Professor and one Associate Professor of the University in
order of seniority on rotation basis for a period of one year;
one educationist not below the rank of Associate Professor from a
panel of three names to be approved by the State Government, for
which the University shall submit a list of three names of eminent
educationists;
the Registrar who shall be a-officio Member Secretary;
the Finance Officer shall have the right to speak in and otherwise
to take part in the proceedings of the Executive Council but shall
not be entitled to vote;
Quorum of the meeting of the Executive Council shall not be less than six
members.
Decisions at any meeting of the Executive Council shall be taken by
majority of the members present at such meeting:
Provided that, in case of tie in any proposal, the proposal having support of
the Vice-Chancellor shall prevail.
26. (1) The Academic Council shall be the principal academic body of the
University and shall subject to the provisions of the Statutes, the Ordinances and
Regulations, co-ordinate and exercise general supervision over the academic policies of
the University. •
(2) The constitution of the Academic Council, the term of office of its
members and its powers and functions shall be such as may be prescribed.
191_RPH_Data 4 Vidhaika Fold - (Adhiniyam_2019)

Wmmfiwmem, 2019
___’______________’———-———
(viii) to fix the honorarium, emoluments, traveling and other allowances
of the examiners; _
(ix) to direct the form and use of the common seal of the University;
(x) to regulate and enforce discipline among members of the teaching,
administrative and other staff of the University in accordance with
the Statutes and Ordinances;
(xi) to manage and regulate the finances, accounts, investments,
property and all other administrative affairs of the University;
(xii) to invest any money belonging to the University including
endowed property; '
(xiii) ' to provide the buildings, premises, -fumiture, equipments,
apparatus and other means needed for carrying on the work of the
University;
(xiv) to enter into, vary, carry out, and cancel contract on behalf of the
University;
(xv) to regulate and determine all other matters concerning the
, University in accordance with this Act, the Statutes, the
Ordinances and the Regulations.
(5) Every decision of the Executive Council shall be informed by the reasons
therefor.
(6) The Vice-Chancellor shall be the Chairperson of the Executive Council,
which shall consist of the following other members, namely :— '
, (i) three members to be nominated by the Governing Body;
(ii) two eminent educationists nominated by the President;
(iii) one officer of the .State Government not below the rank of Joint
Secretary to the Government of Uttar Pradesh;
(iv) one Professor and one Associate Professor of the University in
order of seniority on rotation basis for a period of one year;
(v) one educationist not below the rank of Associate Professor from a
panel of three names to be approved by the State Government, for
which the University shall submit a list of three names of eminent
educationists;
(vi) the Registrar who shall be ax—oflicia Member Secretary;
(vii) the Finance Officer shall have the right to speak in and otherwise
to take part in the proceedings of the Executive Council but shall
not be entitled to vote;
(7) Quorum of the meeting of the Executive Council shall not be less than six
members. "
(8) Decisions at any meeting of the Executive Council shall be taken by
majority of the members present at such meeting:
Provided that, in case of tie in any proposal, the proposal having support of
the Vice-Chancellor shall prevail.
The Academic 26. (l) The Academic Council shall be the principal academic body of the
C°“"°" University and shall subject to the provisions of the Statutes, the Ordinances and
Regulations, co-ordinate and exercise general supervision over the academic policies of
the University. '
(2) The constitution of the Academic Council, the term of office of its
members and its powers and functions shall be such as may be prescribed. -
I91_RPHVData 4 Vidhaika Fold ’ (Adhiniyam_2019)
cr1•4 41 3R11tTRui Jul , 6 3PTF1, 2019
aThetEinance
;Comnattee •
27. (1) The Finance Committee shall be the principal financial body of the
University to take care of the financial matters.
(2) The constitution, powers and functions of the Finance 'Committee shall be
such, as may be prescribed.
28. (1) The Planning Board shall be the principal planning body of the UniverSity.
The Board shall ensure that the infrastructure and academic support system meets the
norms of the University Grants Commission and other Regulatory Bodies.
(2) The constitution, of the Planning Board, term of office of its members and its
powers and functions shall be such as may be prescribed.
29. The constitution, powers and functions of the Board of Facilities, ithe
Admissions Committee, the Examinations Committee and of such other authotaties ofithe
University which may be declared by the Statutes to be authorities of the UniverSity, Shah
be such as may be prescribed.
30. A person shall be disqualified for being a member of any of the authorities or
bodies of the University, if he/she—
(1 )
is of unsound mind and stands so declared by a competenticourt;
is an undischarged insolvent;
has been convicted of any offence involving moral turpitude;
(4). has been punished for indulging in or promoting unfair 'practice un
the conduct of any examination, in any form, anywhere;
has any profit motive from University except salary or any other
authorised emoluments;
applies University fund for his personal use.
31. No decision, Act or proceeding of any authority or body of the University shall
be invalid merely by reason of any vacancy or defect in the constitution thereof.
32. Any vacancy occurred in the membership of any authority or body of the
University due to death, resignation or removal of a member or due to 'Change icif capaCity
in which he was appointed or nominated, shall be filled up as early as possible lby the
person or the body who had appointed or nominated such a member:
Provided that the person appointed or nominated as a member of an authority or
body of the University on an emergent vacancy, shall remain member of such mithofiWor
body, for only the remaining period of the member, in whose place he is ;apprinited or
nominated.
33. The authorities or officers of the University May constitute :such comnfittees or Comniittets
sub-committee with such terms of reference, in conformity with the Act, Statutes,
Ordinances and Regulations, as may be necessary for specific tasks to be performed lby
such committees. The constitution of such committees or sub-committee and thiir duties
shall be such as may be determined by the authority or officer constituting the Comniittee
or sub-committee.
ThelPlanrilog
:Board
1BoardicifiFacalw,
iBoantIrdeStddies,
adnasaions
Comniittee,
Exaniinations
Comniittee:and
(otheriAuthotities
orfithelUtiivera4y
IDisqualiftcation
tfonmeniberghip
cdfaabody
Wacandieanotto
anvalidatetthe
mnxectliogsaif
t.almoarahoi-dycor
ibodyairdhe
Ildriiverady
lEillingarxdf
(emergent
wacanaies
19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWW,6W2M9
27. (1) The Finance Committee shall be the principal financial rbody to’flthe
University to take care of the financial matters.
(2) The constitution, powers and functions of the Finance Committee shall the
such, as may be prescribed.
28. (l) The Flaming Board shall be the principal planning body of the University.
The Board shall ensure that the infrastructure and academic support system meets tthe
norms of the University Grants Commission and other Regulatory Bodies.
(2) The constitution, of the Flaming Board, term of office of its members and its
powers and functions shall be such as may be prescribed.
29. The constitution, powers and functions of the Board of 'Eacu‘ltiies, the
Admissions Committee, the Examinations Committee and of such other authorities (oftthe
University which may be declared by the Statutes to be authorities of the University, shall
be such as may be prescribed. V
30. A, person shall be disqualified for being a member of any of the :authonit'ies (or
bodies of the University, if-he/she—
(l) is of unsound mind and stands so declared by a competent court;
(2) is an undischarged insolvent;
(3) has been convicted of any offence involving moral mmp'itude;
(4). has been punished for indulging in or promoting tinfair practice iin
the conduct of any examination, in any form, anywhere;
(5) has any profit motive from University except salary or :any «other
authorised emoluments;
(6) applies University fund for his personal use.
31. No decision, Act or proceeding of any authority or body ofthe University ss'ha‘ll
[be invalid merely by reason of any vacancy or defect in the constitution thereof.
32. Any vacancy occurred in the membership of any authority or body (of tfhe
University due to death, resignation or removal of a member or due to change «o’flcapacity
in which he was appointed or nominated, shall be filled up as early as possible lby the
person or the body who had appointed or nominated such a member:
Provided that the person appointed or nominated as a member ofan authority (01'
body of the University on an emergent vacancy, shall remain member ofzsuc’h authofiitytor
body, for only the remaining period of the member, in whose place he is appointed (or
nominated. '
33. The authorities or ofiioers of the University may constitute :such committees or
sub-committee with such terms of reference, in conformity with the Act, Statutes,
Ordinances and Regulations, as may be necessary for specific tasks to be performed [by
such committees. The constitution of such committees or sub-conunittee and their duties
shall be such as may be determined by the authority or ofiicer constituting the (Committee
or sub-committee.
l9l_RPHVD2ta 4 Vidhaika Folder (Adhiniyam_20]9)
ilThe lEinance
{Committee
'vThelElanriing
ZBoar'd
lBoardtofiEaciilty,
iBoardtdflStu‘d ies.
lA'dm'iss'ions
(Committee,
Examinations
(Gomm' itteeian'd
(other/Authorities
(o'flthclUniversity '
“Disqualification
{forlmenibertliip
to’fzalbody
\Vacaneiesmottto
iinvtilidatetflte
[proceedingo’f
zanyzauthorityzor
. lboliyuilithe
“University
lEillingiuptof
tetnergent ‘
\vacancies
I
(Gomniittm
42 313119Telf , 6 3111€1, 2019
Power to make
statutes
34i(1))The. first Statutes. of the Universities established or incorporated under
this; Act shall' be made by. the Executive Council and shall be submitted to the State
G'overnmentforithapprovat.
(?)) The Government shall consider the First Statutes submitted by the
UhiersitYyandishallIapproveit within three months from the date of its receipt. If the
State:Government:does; not approve or communicate to the University the objections
thereorn witliiin the tiine mentioned above, statutes so submitted shall be deemed to be
approved!.
(i3))Stibjecttmthe provisions of this Act the Statutes may provide for all or any
ofilliefollOWingmatters,,namely)-
(a)) the constitution; powers and functions of the authorities of the
Illiihrersity,,, as; may be constituted from time to time;
(0)) theappoihtment and continuance in office of the members of the said
authorities) filling of vacancies of members of the said authorities,
filling,ofivacancies of members and all other matters relating to those
authorities; Mr. which it may be necessary to provide;
(a)) the appointment, powers and functions of •the officers of the
University' and their emoluments;
(.0)) the appointment of teachers of the University and other academic and
adinihrstrative: staff and their emoluments;
(e)) the appointment of teachers and other academic and administrative
staffiworking• in the University or Institution for specific period for
undertakingajOint project;
the conditions. of service of employees including provisions for
retirement- benefits, insurance and provident fund, the manner of
temilnatibm of their service and the disciplinary matters;
theprinoMies.goveming seniority of service of employees;
(()) the procedure fOr settlement of disputes between employees or
students; and the: University;
(i)) theprocedize: for appeal to the Executive Council by any employee or
student against the action of any officer or other authority of the
luniVersity;
()i theconferment of honorary degrees;
00) the withdrawal of degree, diploma, certificate and other academic
distinctions;!
(I)) the institution' of fellowships, scholarships, studentships, medals and
priies;;
(in)) themaintenance of discipline among the students;
(n)) the establishment and abolition of Departments, Centers and other
institutions. etc, within the campus of the University;
(0)) the delegation of powers vested in the authorities or officers. of the
EJniVersity;; and
(09) .alllothermafters, as per this Act or as may be prescribed.
(4)) the ExecutiVe Council shall not make, amend or repeal any Statute
affecting; the powers; or constitution of any authority of the University until such
autliorityy has; beem giVert am opportunity of expressing an opinion in writing on the
proposedlchanges; and any, opinion so expressed shall be considered by the Executive
Council!.
a
191_RPH_Data41Willitileafolderi(A'dhifiikami 2019))

42
Power to make
statutes
caram- 3121mm we, 6 m. 2019
3?:3,((l=))lihe'firstStatutes of the Universities established or incorporated under
thi'sua‘cttshallibe:made by: the Executive Council and shall be submitted to the State
Government:fon'itSsapproval;.
(24)) The: Government shall consider the First Statutes submitted by the
Uhii/ersitygandishalllapprovezit within three months from the date of its receipt. If the
Stateervemment‘doesx not approve or communicate to the University the objections
thereoniwithintthe:time:mentioned above, statutes so submitted shall be deemed to be
approvedl. I ,
03))Sirliject-toithe:provisions of this Act the Statutes may provide for all or any
oflthe:follbwii1ggmatters;.namely:-
(‘31)) the: constitution; powers and functions of the authorities of the
Uhi‘vensitysasx may be constituted from time to time; ‘ ‘
(115)) therappoi'ntment and continuance in office of the members of the said
authorities; filling of vacancies of members of the said authorities,
filli'nggofi’vacancies of members and all other matters relating to those
authorities fc'm‘ which it may be necessary to provide;
(’c)) the: appointment; powers and functions of the officers of the
UniVersity'andl their emoluments; ' _
(6)) the: appointment of teachers of the University and other academic and
administrative staff and their emoluments; I
((6)) the-appointment of teachers and other academic and administrative
stafifi'wortl'tingx in the University or Institution for specific period for
und'ertakingna joint project;
(vi)) the: conditions of service of employees including provisions for
retirement? benefits, insurance and provident fund, the manner of
tenninatiomof their service and the disciplinary matters;
6g» the-principlesgoverning seniority of service of employees;
(W flier procedure, for settlement of disputes between employees or
students; and; the: University;
(ti)) flie3proced'ure: for appeal to the Executive Council by any employee or
- student» against the action of any officer or other authority of the '
University; '
GD) tl'te'conferment of honorary degrees;
(It) the: withdrawall of degree, diploma, certificate and other academic
distinctions;
(Il)) . die:instituti'om of fellowships, scholarships, studentships, medals and
prizes; '
(-3113) thermai'ntenance of discipline among the students;
61)) the» establishment and abolition of Departments, Centers and other
institutions etc; within the campus of the University;
(bi) the delegation of powers vested in the authorities or officers. of the
[UhiiIersityvuand
(12)) .alllotfienmatters, as per this Act or as may be prescribed.
(’49) "Elie: Executive Council shall not make, amend or repeal any Statute
affecting), the: powers; on constitution of any authority of the University‘until such
authority/ hastbeent giIvent am opportunity of expressing an opinion in writing on the
Egfisiolchangeszandlanygopi'nion so expressed shall be considered by the Executive
or ..
l9l.RPH_Da:al4l VifllinilirFéld'erKA’dhiniyaml 2019))
dcyW Tra7T 3T-iiNNW 1i1 6 311111., 2019 43
35. Subject to the provisions of this Act and the Statutes, the Ordinances shall Power to make
be made by the Executive Council which may provide for all or any of the following Ordinances
matters, namely:-
the admission of students to the University and their enrolment as such;
the courses of study to be laid down for all degrees, diplomas and
certificates of the University;
the medium of instruction and examinations;
the award of degrees, diplomas, certificates and other academic
distinctions, the qualifications for the same and the measures to be
taken relating to the granting and obtaining of the same;
the fees to be charged for courses of study in the University and for
admissions to the examinations, degrees, diplomas and certificates of
the University;
the conditions for the award of fellowships, scholarships, studentships,
medals and prizes;
the conduct of examinations, including the term of office and manner
of appointment and the duties of examining bodies, examiners and
moderators;
(h) the conditions of residence of the students of the University;
(i) the special arrangements, if any, which may be made for the residence,
discipline and teaching of women students and prescribing of special
courses of studies for them within the University;
(j) the appointment and emoluments of employees other than those for
whom provision has been made in the Statutes;
the establishment of Centre of Studies, Board of Studies,
Interdisciplinary Studies, Special Centers, Specialized Laboratories and
other Committees;
the manner of co-operation and collaboration with other Universities
and authorities including professional bodies or associations;
the creation, composition and functions of any other body which is
considered necessary for improving the academic stature of the
University;
the remuneration to be paid to the examiners, moderators, invigilators
and tabulators; and
such other terms and conditions of service of teachers and other
academic staff as are not prescribed by the Statutes.
36. (1) The Annual Report of the University shall be prepared under the direction
of the Executive Council and shall be submitted to the Governing Body on such date as
may be prescribed and the Governing Body shall consider the report in its annual
meeting.
(2) The Governing Body shall submit its comments on the Annual Report to the
Executive Council for its considerations.
37. (1) The Annual Accounts and Balance Sheet of the University shall be
prepared under the directions of the Executive Council/ad. d• shall, once at least every
year and at intervals of not more than fifteen months, be audited by an experienced and
qualified firm of Chartered Accountants of repute.
(2) A copy of the Annual Accounts, together with the audit report thereon, shall
be submitted to the Governing Body and the Chancellor/President along with the
observations of the Executive Council.
(k)
(I)
(m)
Annual Report
Annual
Accounts
19I_RPH_Data 4 Vidhaika Folder (Adbiniyam_2019)

Wmmwmam, 2019 - 43
_—__’__—_——————————
35. Subject to the provisions of this Act and the Statutes, the Ordinances shall P0W_6”° make
be made by the Executive Council which may provide for all or any of the following 0mmm°es
matters, namely:- .
(a) the admission of students to the University and their enrolment as such;
(b) the courses of study to be laid down for all degrees, diplomas and
certificates of the University;
(c) the medium of instruction and examinations;
(d) the award of degrees, diplomas, certificates and other academic
distinctions, the qualifications for the same and the measures to be
taken relating to the granting and obtaining of the same;
'(e) the fees to be charged for courses of study in the University and for
admissions to the examinations, degrees, diplomas and certificates of
the University;
(f) the conditions for the award of fellowships, scholarships, studentships,
medals and prizes; ' _
_ (g) the condiict of examinations, including the term of office and marmer
‘ ,, of appointment and the duties' of examining bodies, examiners, and
moderators; '
’ - ' (h) the conditions of residence of the students of the University;
(i) the special arrangements, if any, which may be made for the residence,
discipline and teaching of women students and prescribing of special
courses of studies for them within the University; '
(j) the appointment and emoluments of employees other than those for
whom provision has been made in the Statutes;
(k) the establishment of Centre of Studies, Board of Studies,
Interdisciplinary Studies, Special Centers, Specialized Laboratories and
other Committees;
(1) the manner of co—operation and collaboration with other- Universities
and authorities including professional bodies or associations;
' (m) the creation, composition and functions of any other body which is
considered necessary for improving the academic stature of the
University; ,
(n) the remuneration to be paid to the examiners, moderators, invigilators
and tabulators; and ,
i (0) such other terms and conditions of service of teachers and other
academic staff as are not prescribed by the Statutes.
36. (l) The Annual Report of the University shall be prepared under the direction Annual R690"
of the Executive Council and shall be submitted to the Governing Body on such date as '
may be prescribed and the Governing Body shall consider the report in its annual
meeting.
(2) The Governing Body shall submit its comments on the Annual Report to the
Executive Council for its considerations. . .
37. (l) The Annual Accounts and Balance Sheet of the University shall be Annual
prepared under the directions of the Executive Council {and .shall, once at least every ”cm“
year and at intervals of not more than fifteen months, be audited by an experienced and
qualified firm of Chartered Accountants of repute.
(2) A copy of the Annual Accounts, together with the audit report thereon, shall
be submitted to the Goveming Body and the Chancellor/President along with the j
observations of the Executive Council.
i914iu>Hme 4 Vidltaika Folder (Adhiniyam_20]9)
44
sict-N cth 31Rilt•TRuf wl d, 6 3179?1, 2019
Conditions of
service of
employees
Right to Appeal
Employees .
Provident Fund
and Pensions
Mode of proof of
University
records
!Publication of
Statues,
Ordinances and
Regulations
Pennanent
Endowment
Fund
(3) Any observations made by the President on the annual accounts shall be
brought to the notice of the Governing Body and the Executive Council and the
observations, if any, shall, after review by the Executive Council, be submitted to the
Chancellor/President and shall be put in the public domain.
38. (1) Every employee of the University shall be appointed/engaged as per the
provisions of this Act and Statutes made thereunder.
Any dispute arising between the University and any of the regular employees,
shall be referred to the Vice-Chancellor who shall decide the dispute after affording an
opportunity to the employee within three months from the- date of receipt of its
reference.
Any dispute in respect of any etftployee engaged temporarily or on ad-hoc or
part time or casual basis shall be heard and decided by the Vice-Chancellor.
39. (1) An aggrieved person may prefer an appeal to the Chancellor/President
against any decision of an officer or authority of the University within a period of three
months from the date of receipt of such decision:
Provided that the Chancellor/President shall have power to condone the delay
if he is satisfied that the appellant for sufficient reasons could not have preferred this
appeal within the stipulated time.
(2) Any decision taken by the Chancellor/President in such an appeal shall be
final.
40. The University shall constitute for the benefit of its employees such pension
or welfare schemes or Provident Fund or provide such insurance schemes as it may
deem fit in such manner and subject to such conditions as may be decided by the
Executive Council.
41. A copy of any receipt, application, notice, proceeding, resolution of any
authority or Committee of the University or other documents in possession of the
University, if certified by the Registrar, shall be received as prima-facie evidence of the
such receipt, applications, notice, order, proceeding or resolution, documents or the
existence of entry in the register and shall be admitted as evidence of the matters and
transactions therein where the original would, if produced, have been admissible in
evidence.
42. Every Statute, Ordinances and Regulations made under this Act shall be
published by the University.
43. (1) The Sponsoring body shall establish a permanent Endowment Fund of at
least Its. 5 (five) crore.
The Endowment fund shall be used as security deposit to ensure that the
University complies with the provisions of this Act and functions as per provisions of
this Act, the Statutes, the Ordinances and the Regulations. The State Government shall
have the powers to forfeit, a part or whole of the Endowment Fund, in case the
University or the Sponsoring Body contravenes the provisions of this Act, the Statutes,
the Ordinances or the Regulations made thereunder.
The University may utilize the income from Endowment Fund for the
development of infrastructures of the University or for meeting the recurring
expenditure of the University.
The amount of Endowment Fund shall be invested in such instruments as the
State Government may prescribe by rules and shall be kept invested until the dissolution
of the University.
9I_RPH_Data 4 Vidhaika Fold. (Adhiniyam_2019)

44‘
Wmmwmtmjmg
Conditions of
service of
employees
Right to Appeal
Employees .
Provident Fund
and Pensions
Mode of proof of
University
records
Publication of
Statues,
Ordinances and
Regulations
Permanent
Endowment
Fund
(3) Any observations made by the President on the annual accounts shall be
brought to the notice'of the Governing Body and the Executive Council and the
observations, if any, shall, afier review by the Executive Council, be submitted to the
Chancellor/President and shall be put in the public domain.
38. (1) Every employee of the University shall be appointed/engaged as per the
provisions of this Act and Statutes made thereunder.
(2) Any dispute arising between the University and any of the regular employees,
shall be referred to the Vice-Chancellor who shall decide the dispute afier affording an
opportunity to the employee within three months from the" date of receipt of its
reference.
(3) Any dispute 1n respect of any employee engaged temporarily or on ad— hoc or
part time or casual basis shall be heard and decided by the Vice-Chancellor.
39. (1) An aggrieved person may prefer an appeal to the Chancellor/President
against any decision of an officer or authority of the University within a period of three
months from the date of recerpt of such decision:
Provided that the Chancellor/President shall have power to condone the delay
if he 15 satisfied that the appellant for sufficient reasons could not have preferred- -his
appeal within the stipulated time.
(2) Any decision taken by the Chancellor/President in such an appeal shall be
final. _ ’ .
40. The University shall constitute for the benefit of its employees such pension
or welfare schemes or Provident Fund or provide such insurance schemes as it may '
deem fit in such manner and subject to such conditions as may be decided by the
Executive Council.
41. A copy of any receipt, application, notice, proceeding, resolution of any
authority or Committee of the University or other documents in possession of the
University, if certified by the Registrar, shall be received as prima-facie evidence of the
such receipt, applications, notice, order, proceeding or resolution, documents or the
existence of entry in the register and shall be admitted as evidence of the matters and
transactions therein where the original would, if produced, have been admissible in
' evidence.
42. Every Statute, Ordinances and Regulations made under this Act shall be
published by the University. ‘
43. (1) The Sponsoring body shall establish a permanent Endowment Fund of at
least Rs. 5 (five) crore.
(2) The Endowment fund shall be used as security'deposit to ensure that the
University complies with the provisions of this Act and fimctions as per provisions of
this Act, the Statutes, the Ordinances and the Regulations. The State Government shall
.have the powers to forfeit, a part or whole of the Endowment Fund, in case the
University or the Sponsoring Body contravenes the provisions of this Act, the Statutes,
the Ordinances or the Regulations made thereunder.
(3) The University may utilize the income from Endowment Fund for the
development of infrastructures of the University or for meeting the recurring
expenditure of the University.
(4) The amount of Endowment Fund shall be invested' in such instruments as the
State Government may prescribe by rules and shall be kept invested until the dissolution
of the University.
l9l_RPH'Data 4 Vidhaika Fold: {Adhiniyum_2019)
Niatt A—kW 31311tITRuf hlotd, 6 31Wf, 2019
(5) In case of investment in long term security, and in case of deposit in the
interest bearing Personal Deposit Account in the Government Treasury, deposit shall be
made with the condition that the amount shall not be withdrawn or utilized without the
prior permission of the State Government.
44. (1) The University shall establish a general fund to which the following
amount shall be credited, namely:-
all fees which may be charged by the University;
all sums received from any other sources;
all contributions made by the Society ; and
all contributions made in this behalf by any other person or bodies
which are not prohibited by any law for the time being in force.
(2) The money credited to the general fund shall be applied to meet all the
recurring expenditures of the University. •
45. (I) The University shall also establish a development fimd to which the
following moneys shall be credited, namely:—
development fees, which may be charged from students;
all sums received from other sources for the purpose of the
development of the University;
all contributions made by the Sponsoring Body;
all contributions made in this behalf bj, any other person or bodies
which are not prohibited by any law for the time being' in force; and
all incomes received from the permanent endowment fund.
(2) The moneys credited to the development fund from time to time shall be
utilized for the development of the University.
46. All funds e§tablished under this Act shall subject to general supervision and
control of the Executive Council and be regulated and maintained in such manner as
may be prescribed.
47. The University shall not be eligible for any grants in aid or any financial
assistance from the State Government or any other body or Corporation owned and
controlled by the State Government.
48. The fee structure for all purposes shall be decided by the Executive Council
provided that the University shall not charge any fee from its students in excess of what
is required under any law of the State Government at the time being in force or as fixed
by the Regulatory Bodies and the fees structure shall be put in public domain.
49. Within a period of five years from commencement of programmes, the
University shall obtain NAAC and other such accreditations as may be prescribed by
the State Government from time to time. It shall also obtain certification/accreditation
from such other Regulating Bodies which are connected with the courses taken up by
the University. It shall inform the State Government about the grade provided to the
University. The University shall ensure renewal of such accreditation from time to time.
50. The convocation of the University shall be held in every academic year in
the manner as may be prescribed by the Statutes, the Ordinances and the Regulations
for conferring degrees, diplomas or for any other purpose.
51. (1) To ensure the compliance of the provisions of this Act, Statutes,
Ordinances and Regulations made thereunder, the Uttar Pradesh State Higher Education
Councilstall be the nodal agency.
General Fund
Development
Fund
Maintenance of
Funds
The University
shall be self
financed
Fees
Accreditation of
the University
Convocation
The Uttar Pradesh
Higher Education
Council shall be
the nodal agency
for Private
Universities
19I_RPH_Data 4 11(idhaika Folder (Adhiniyam_2019)

WWWW, 6 W, 2019
(5) In case of investment in long term security, and in case of deposit in the
interest bearing Personal Deposit Account in the Government Treasury, deposit shall be
made with the condition that the amount shall not be withdrawn or utilized without the
prior permission of the State Government.
44. (1) The University shall establish a general fund to which the following
amount shall be credited, namely:-
(a) all fees which may be charged by the University;
(b) all sums received from any other sources;
(c) all contributions made by the Society ; and
(d) all contributions made in this behalf by any other person or bodies
which are not prohibited by any law for the time being 1n force.
(2) The money credited to the general fund shall be applied to meet all the
recurring expenditures of the University.
‘45. (l) The University shall also establish a development fund to which the
following moneys shall be credited, namely:—
(a) development'fees, which may be charged from students;
(b) all sums received from other sources for. the purpose of the
development of the University;
(c) all contributions made by the Sponsoring Body;
(d) all contributions made' 1n this behalf by any other person or bodies
which are not prohibited by any law for the time being” in force; and
(e) all incomes received from the permanent endowment fund.
(2) The moneys credited to the development fund fi'om time to time shall be
utilized for the development of the University.
46 All funds established under this Act shall subject to general supervision and
control of the Executive Council and be regulated and maintained 1n such manner as
may be prescribed. .
47. The University shall not be eligible for any grants in aid or any financial
assistance fi'om the State Government or any other body or Corporation owned and
controlled by the State Government. \
, 48. The fee structure for all purposes shall be decided by the Executive Council
provided that the University shall not charge any fee from its students in excess of what
is required under any law of the State Government at the time being in force or as fixed
by the Regulatory Bodies and the fees structure shall be put in public domain.
49. Within a period of five .years fi'om commencement of programmes, the
University shall iobtain NAAC and other such accreditations as may be prescribed by
the State Government from time to time. It shall also obtain certification/accreditation
from such other Regulating Bodies which are connected with the courses taken up by
the University. It shall inform the State Government about the grade provided to the
University. The University shall ensure renewal of such accreditation from time to time.
50. The convocation of the University shall be held in every academic year in
the manner as may be prescribed by the Statutes, the Ordinances and the Regulations
for conferring degrees, diplomas or for any other purpose.
5]. (1) To ensure the compliance of the provisions of this Act, Statutes,
Ordinances and Regulations made thereunder, the Uttar Pradesh State Higher Education
Councilrs‘hall be the nodal agency.
5*
,
191 _RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)
45
General Fund
Development
Fund
Maintenance of
Funds
The University
shall be self
financed
Fees
Accreditation of
. the University
Convocation
The Uttar Pradesh
Higher Education
Council shall be
the nodal agency
for Private
Universities
46 WaT 31W11%197 4 I'4d, 6 3171-€1, 2019
Power of State
Government to call
for information and
records
Dissolution of
University
Expenditure of the
University during
dissolution
Winding up of the
University by the
State Government
The records of the students admitted to the different courses of the University
and their results and the records of the students not appearing in the examinations shall
be provided to the Uttar Pradesh Higher Education Council. The final degree shall be
conferred to the students with approval of the Uttar Pradesh Higher Education Council.
The names of the persons to be awarded the degrees shall be submitted to The Uttar
Pradesh Higher Education Council before 30 days of the date of convocation and the
Council shall approve the list. In case approval of the Council is not communicated to
the University within 20 days, the list shall be deemed to be approved.
The Uttar Pradesh Higher Education Council may call from the University or
any authority or officer of the University to furnish any information or records of the
University within specified date and time failing which the Uttar Pradesh Higher
Education Council may send the report to the State Government for appropriate action.
The Uttar Pradesh Higher Education Council shall conduct atleast one annual
inspection of the Universities established under this Act for the purpose of compliance
of the provisions of this Act and to ensure imparting of quality education and submit its
annual inspection report to the State Government specifically regarding the compliance
of the undertaking given under section 3 of this Act.
(1) It shall be the duty of the University or any authority or officer of the
University to furnish such information or records relating to the administration or
finances and other affairs or activities etc. of the University as the State Government
may call for.
(2) The State Government, if it is of the view that there is a violation of the Act,
the Statutes, the Ordinances or the Regulations made thereunder may issue such
directions to the University under this Act as it may deem necessary, and the University
shall comply with such directions within the stipulated time.
(I) If the University proposes its dissolution in accordance with the law
governing its constitution or incorporation, it shall give at least one year's written notice
to the State Government.
(2) On receipt of notice referred to in sub-section (1), the State Government shall
make such arrangements for administration of the University from the date of
dissolution of the University and until the last batch of students in regular courses of,
studies of the University complete their courses or studies in such manner as may be
prescribed.
(1) The expenditure for administration of the University during the taking
over of the liabilities of the University under section 53 of the Act shall be met out of
the Permanent Endowment Fund, the general fund and the development fund.
(2) During this process, if the funds referred to in sub-section (1) are not
sufficient to meet the expenditure and the liabilities of the University, such expenditure
may be met by disposing off the properties and assets of the University by the State
Government.
(1) If it appears to the State Government that the University has contravened
any of the provisions of this Act, Statutes, Ordinances or Regulations made thereunder
or has violated any of the directions issued by it under this Act or has ceased to carry
out any of the undertakings given under section 3 or there is fraud or misappropriation
or serious misuse of funds, it may issue direction to the Uttar Pradesh Higher Education
Council to conduct preliminary inquiry.
(2) If the State Government, on receipt of inquiry report of the University on the
direction issued under sub-section (1), is satisfied that there is a prima facie case of
contravention of all or any of the provisions of this Act or the Statutes or Ordinances or
Regulations made thereunder or of violation of directions issued by it under this Act or
of ceasing to carry out the undertaking given under section 3, or there is fraud or
misappropriation or serious misuse of funds, it shall make an order of such enquiry as it
may consider necessary.
19I_RPHJDzaa 4 Vidhaika Folder (Adhiniyam_2019)

Power of State
Government to call
for information and
records
Dissolution of
. University
Expenditure of the
' University during
dissolution
Winding up ofthe
University by the
State Government
Tic—(1? “a? W 1 GE, 6 GP F1, 2019
(2) The records of the students admitted to the different courses of the University
and their results and the records of the students not appearing in the examinations shall
be provided to the Uttar Pradesh Higher Education Council. The final degree shall be
conferred to the students with approval of the Uttar Pradesh Higher Education Council.
The names of the persons to be awarded the degrees shall be submitted to The Uttar
Pradesh Higher Education Council before 30 days of the date of convocation and the
Council shall approve the list. In case approval of the Council is not communicated to
the University within 20 days, the list shall be deemed to be approved.
(3) The Uttar Pradesh Higher Educatimi Council may call from the University or
any authority or ofi‘icer of the University to furnish any information or records of the
University within specified date and time failing which the Uttar Pradesh Higher
Education Council may send the report to the State Government for appropriate action.
(4) The Uttar Pradesh Higher Education Council shall conduct atleast one annual
inspection of the Universities established under this Act for the purpose of compliance
of the provisions of this Act and to ensure imparting of quality education and submit its
annual inspection report to the State Government specifically regarding the compliance
of the undertaking given under section 3 of th15 Act.
52. (1) It shall be the duty of the University or any authority or officer of the
University to fumish such information or records relating to the administration or
finances and other affairs or activities etc. of the University as the State Government
may call for.
(2) The State Government, if 1t is of the View that there 15 a violation of the Act,
the Statutes, the Ordinances or the Regulations made thereunder may issue such
directions to the University under this Act as it may deem necessary, and the University
shall comply with such directions within the stipulated time.
53. (1) If the University proposes its dissolution in accordance ‘with the law
governing its constitution or incorporation, it shall give at least one year’s written notice
to the State Government.
(2) On receipt of notice referred to in sub-section (1), the State Government shall
make such arrangements for administration of the University from the date of
dissolution of the University and until the last batch of students in regular courses of
studies of the University complete their courses or studies 1n such manner as may be
prescribed. -
54. (1) The expenditure for administration of the University during the taking
oi/er of the liabilities of the University under section 53 of the Act shall be met out of
the Permanent Endowment Fund, the general fund and the development fund.
(2) During this process, if the funds referred to in sub-section (1) are not
sufficient to meet the expenditure and the liabilities of the University, such expenditure
may be met by disposing off the properties and assets of the University by the State
Government. .
55. (1) If it appears to the State Government that the University has contravened
any of the provisions of this Act, Statutes, Ordinances or Regulations made thereunder
or has violated any of the directions issued by it under this Act or has ceased to carry
out any of the undertakings given under section 3 or there is fraud or misappropriation
or serious misuse of funds, it may issue direction to the Uttar Pradesh Higher Education
Council to conduct preliminary inquiry.
(2) If the State Government, on receipt of inquiry report of the University on the
direction issued under sub-section (1), is satisfied that there is a prima facie case of
contravention of all or any of the provisions of this Act or the Statutes or Ordinances or
Regulations made thereunder or of violation of directions issued by it under this Act or
of ceasing to carry out the undertaking given under section 3, or there is fraud or
misappropriation or serious misuse of funds, it shall make an order of such enquiry as it
may consider necessary.
l9l_RPH_Data 4 Vidhaika Folder (Adhiniynijlg)
\icth Ift31 3TUTETRUT , 6 3179?1, 2019
(3) For the purposes of an inquiry under sub-section (2), the State Government
shall, by notification, appoint an officer or a committee on the recommendation of the
Uttar Pradesh Higher Education Council as the inquiring authority to inquire into the
allegations of violation of the provisions of this Act.
(4) Every inquiring authority appointed under sub-section (3) shall while
performing its functions under this Act have all the powers of Civil Court under the
Code of Civil Procedure, 1908 while trying a suit and in particular in respect of the
following matters, namely:-
summoning and enforcing the attendance of any witness and examining
him on oath;
requiring the discovery and production of any document;
requisitioning any public record or copy thereof from any office;
receiving evidence on affidavit; and
any other matter which may be prescribed.
(5) If, upon receipt of the inquiry report, the State Government is satisfied that
the University has violated any provisions of this Act and there is a need for corrective
action, the State Government shall direct the University to make necessary
improvements within the specified time, in order to comply with the provisions of this
Act. If the University fails to comply with such directions within specified time, the
State Government may again direct the University to make necessary improvements or
modifications within a period of 15 days from the issuance of such directions.
(6) On receipt of the enquiry report from the enquiry officer or the enquiry
committee appointed under sub-section (3), if the State Govemment is satisfied that the
University has contravened all or any of the provisions of this Act or the Statutes or
Ordinances or Regulations made thereunder or has violated any of the directions issued
by it under this Act including directions issued under sub-section(5) above or has ceased
to carry out the undertakings given by it under section 3 or there is fraud or
misappropriation or serious misuse of funds in the University which threatens the
academic standard of the University, the State Government for liquidation of the
University, shall appoint a interim committee consisting of three members to run the
affairs of the University during the period.
(7) (i) The interim committee appointed under sub-section (6) shall have all the
powers to administer the affairs of the University until the last batch of the students of
the regular courses have completed their courses and they have been awarded degrees,
diplomas or awards as the case may be;
After having been awarded the degrees, diplomas or awards, as the case may
be, to the last batches of the students of the regular courses, the interim committee shall
make a report to the effect to the State Government;
On receipt of the report under sub-section (7) (ii), the State Government
shall, by a notification in the Official Gazette, issue an order dissolving the University
and from the date of publication of such notification, the University shall stand dissolved
and all the remaining assets and liabilities of the University shall vest in the sponsoring
body from such date.
(8) Every notification under sub-section (7), shall be laid before both Houses of
the State Legislature.
56. The State Government may issue such directions from time to time to the
University on policy matters not inconsistent with the provisions of this Act as it may
deem necessary. Such directions shall be complied with by the University, failing which
the State Government may take a reasoned action against the University in accordance
with this Act.
Power of the
State Government
to issue directions
on policy matters
191_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)
•

WWWW,6W, 2019
(3) For the purposes of an inquiry under sub-section (2), the State Government
shall, by notification, appoint an officer or a committee on the recommendation of the
Uttar 'Pradesh Higher Education Council as the inquiring authority to inquire into the
allegations ofviolation ofthe provisions ofthis Act. ‘
(4) Every inquiring authority appointed under sub~section (3) shall while
performing its functions under this Act have all the powers of Civil Court under the
Code of Civil Procedure, 1908 while trying a suit and in particular in respect of the
following matters, namely:- '
(a) summoning and enforcing the attendance of any witness and examining
him on oath;
(b) requiring the discovery and production of any document;
(c) requisitioning any public record or copy thereof from any office;
(d) receiving evidence on affidavit; and
(e) any other matter which may be prescribed.
(5) If, upon receipt of the inquiry report, the State Government is satisfied that
the University has violated any provisions of this Act and there is a need for corrective
action, _ the State Government shall direct the University to make necessary
improvements within the specified time, in order to comply with the provisions of this
Act. If the University fails to comply with such' directions within specified time, the
State Government may again direct the University to make necessary improvements or
modifications within a period of 15 days from the issuance of such directions.
(6)_On receipt of the enquiry report fi'om the enquiry officer or the enquiry
committee appointed under sub-section (3), if the State Government is satisfied that the
University has contravened all or any'of the provisions of this Act or the Statutes or
Ordinances or Regulations made thereunder or has violated any of the directions issued
by it under this Act including directions issued under sub-section(5) above or has ceased
to carry out the undertakings given by it under section 3 or there is fraud or
misappropriation or serious misuse of funds in the University which threatens the
academic standard of the University, the State Government for liquidation of the
University, shall appoint a interim committee consisting of three members to run the
affairs of the University during the period. I
(7) (i) The interim committee appointed under sub-section (6) shall have all the
powers to administer the affairs of the University until the last batch of the students of
the regular courses have completed their courses and they have been awarded degrees,
diplomas or awards as the case may be;
(ii) Afier having been awarded the degrees, diplomas or awards, as the case may
be, to the last batches of the students of the regular courses, the interim committee shall
make a report to the effect to the State Government;
(iii) On receipt of the report under sub-section (7) (ii), the State Government
shall, by a notification in the Official Gazette, issue an order dissolving the University
and from the date of publication of such notification, the University shall stand dissolved
and all the remaining assets and liabilities of the University shall vest in the sponsoring
body fiom such date. _
(8) Every notification under sub—section (7), shall be laid before both Houses of
the State Legislature.
56. The State Government may issue such directions from time to time to the
University on policy matters not inconsistent with the provisions of this Act as it may
deem necessary. Such directions shall be complied with by the University, failing which
the State Government may take a reasoned action against the University in accordance
with this Act.
l9l_R.PH>Data 4 Vidhaika Folder (Adhiniyam_2019)
1
47
Power of the
State Government
to issue directions
on policy matters
48 14 Yr 3711T-TRuT Iv1d, 6 3171R?f, 2010
Power to remove
difficulties
Repeal and savings
Minority Private
Universities
57. All residual assets and properties including permanent endowment fund,
general fund or any other fund and the liabilities of the University shall belong to the
Sponsoring Body in case of dissolution of the University under any provision
mentioned herein above in the Act.
58. (1) The State Government may, by notification in the Gazette, make rules
for carrying out the purposes of this Act.
(2) Without prejudice to the generality of the foregoing provisions, such rules
may provide for all or any of the following matters, namely:-
the manner of making proposal to establish a University and the
application fees payable under sub-section (1) of section 4;
other particulars to be contained in the Project Report under
sub-section (2) of section 4;
other matters which are required to be, or may be, prescribed by rules
under this Act.
59. (1) The State Government may for the purposes of removing any
difficulties, particularly in relation to the transition from the provisions of the
individual Private University Acts to the provisions of this Act, direct that the
provisions of this Act shall during such period as may be specified in the order, have
effect subject to such adaptations, whether by way of modification, addition or
omission, as it may deem necessary or expedient:
Provided that no such order shall be made after two years from the date of
commencement of this Act.
(2) Every order made under sub-section (1) shall be laid before both Houses of
State Legislature as soon as may be after it is made.
60. All disputes arising as a result of the provisions made in this Act shall be
settled by a Court of law in the State of Uttar Pradesh.
61. The provisions of this Act and the Statutes, Ordinances and Regulations
made there under shall have effect notwithstanding anything to the contrary contained
in any other law, for the time being in force, made by the State Legislature relating to
Universities.
62. (1) All the Acts enumerated in the Schedule-1 to this Act shall stand
repealed on the commencement of this Act.
Notwithstanding the repeal of the Acts enumerated in the Schedule-1
mentioned in sub-section (1), all the decisions made, Acts performed, rights and
liabilities created and exhausted by the Universities established under the repealed
Acts shall be deemed to be valid under this Act.
The Universities incorporated into this Act shall modify their Statutes,
Ordinances and Regulations applicable thereto under their respective repealed Acts, to
bring them in conformity with the provisions of this Act within a period of one year
from the date of commencement of this Act.
63. Notwithstanding anything contained in this Act the University established
by a religious or linguistic minority of the State of Uttar Pradesh, shall continue to
have the privileges as guaranteed by Article 30 of the Constitution of India.
•
Status of Assets /
Liabilities on
dissolution /
de-re,cognition
Power to make rules
Disputes to be settled
in a Court in Uttar
Pradesh
The Ordinance to
have overriding effect
19I_RPH Data 4 Vidhaika Fr er (Adhiniyam_2019)

48 WWWW,GW,ZO19 V
_—____—_’____—_—————I—
Slams “Asset-W 57. All residual assets and properties including permanent endowment fund,
5:33:33" general fund or any other fund and the liabilities of the University shall belong to the
de-recognition Sponsoring Body 'in case of dissolution of the University under any provision
mentioned herein above in the Act. ‘
Power 10 make rules 58. (l) The State Government may, by notification in the Gazette, make rules
' for carrying out the purposes of this Act. ,
(2) Without prejudice to the generality of the foregoing provisions, such rules
may provide for all or any of the following matters, namely:- ‘
(a) the manner of making proposal to establish a University and the
application fees payable under sub-section (1) of section 4;
(b) other particulars to be contained in the Project Report under
sub-section (2) of section 4;
(c) other matters which are required to be, or may be, prescribed by rules
under this Act.
Powerlomnove 59. (l) The State Government may for the purposes of removing any
d'mcuh'es difficulties, particularly in relation to the transition from the provisions of the
individual Private University Acts to the provisions of this Act, direct that the
provisions of this Act shall during such period as may be specified in the order, have
effect subject to such adaptations, whether by wayvof modification, addition or
omission, as_it may deem necessary or expedient:
Provided that no such order shall be made alter two years from the date of
commencement of this Act.
(2) Every order made under sub-section (1) shall be laid before both Houses of
State Legislature as soon as may be afier it is made.
PisputeSfltbc settled 60. All disputes arising'vas a result of the provisions made in this Act shall be
'" “com '" um" settled by a Court of law in the State of Uttar Pradesh.
Pradesh -
The Ordinflnw '0 61.‘ The provisions of this Act and the Statutes, Ordinances and Regulations
have “midi“ me" made there under shall have effect notwithstanding anything to the contrary contained
in any other law, for the time being in force, made by the State Legislature relating to
Universities. ' ‘
Repeal and Savings 62. (l) All the Acts enumerated in the Schedule-l to this Act shall stand
- repealed on the commencement of this Act.
(2) Notwithstanding the repeal of the Acts enumerated in the Schedule-1
mentioned in sub-section (1), all the decisions made, Acts performed, rights and
liabilities created and exhausted by the Universities established under the repealed
Acts shall be deemed to be valid under this Act.
(3) The Universities incorporated into this Act shall modify their Statutes,
Ordinances and Regulations applicable thereto under their respective repealed Acts, to
bring them in conformity with the provisions of this Act within a period of one year
fi‘om the date of commencement of this Act.
Milfon'ty Private ' 63. Notwithstanding anything contained in this Act the University established
”mam“ by a religious or linguistic minority of the State of Uttar Pradesh, shall continue to
have the privileges as guaranteed by Article 30 of the Constitution of India.
l9l_RPHVDnta 4 Vidhaika Fr er (AdhiniyamAZOI9)
\iati SItT 3WIT1Rui 1lJ1C 6 3T1Ti?1, 2019
SCHEDULE-1
(See Section-8)
SI. Details of the Act Name of the University
1 The Integral University Act, 2004
(U.P. ACT NO. 9 OF 2004) Notification Dated
27-02-2004 .
The Integral University, Luckrtow
2 The Amity University Uttar Pradesh Act, 2005
(U.P. ACT NO. 11 OF 2005) Notification Dated
24-03-2005
Amity University Gautambudh Nagar,
Uttar Pradesh
3 The Mangalayatan University Uttar Pradesh Act, 2006
(U.P. ACT NO. 32 OF 2006) Notification Dated
30-10-2006
Mangalayatan University Aligarh, Uttar
Pradesh
4 The Swami Vivekanand Subharti University Uttar
Pradesh Act, 2008
(U.P. ACT NO. 29 OF 2008) Notification Dated
05-09-2008
Swami Vivekanand Subharti
University, Merrut, Uttar Pradesh
5 The Teerthanker Mahaveer University Uttar Pradesh
Act, 2008
(UP. ACT NO. 30 OF 2008) Notification Dated
05-09-2008
Teerthanker Mahaveer University,
Moradabad, Uttar Pradesh
6 The Sharda University Uttar Pradesh Act, 2009
(U.P. ACT NO. 14 OF 2009) Notification Dated
24-03-2009
Sharda University Greater Noida, Uttar
Pradesh
7 The GLA University Uttar Pradesh Act, 2009
(U.P. ACT NO. 21 OF 2010) Notification Dated
01-09-2010
GLA University Mathura, Uttar
Pradesh
8 The Invertis University Uttar Pradesh Act, 2009
(U.P. ACT NO. 22 OF 2010) Notification Dated
01-09-2010
invertis University Bareilly, Uttar
Pradesh
9 The Monad University Uttar Pradesh Act, 2010
(U.P. ACT NO. 23 OF 2010) Notification Dated
12-10-2010
Monad University Gaziabad,
Uttar Pradesh
10 The Noida International University Uttar Pradesh Act,
2010
(U.P. ACT NO. 27 OF 2010) Notification Dated
12-10-2010
Noida International University Gautam
Buddha Nagar, Uttar Pradesh
11 The IFTM University Uttar Pradesh Act, 2010
(U.P. ACT NO. 24 OF 2010) Notification Dated
12-10-2010
IFTM University, Omkar Dham
Lodhipur Rajput, Delhi Road
Moradabad
12 Shri Venkateshwara University Uttar Pradesh Act,
2010
SOP. ACT NO. 26 OF 2010) Notification Dated
,1:.12:10-2010
Shri Venlcateshwara, Gajraula, J.P.
Nagar
/
The Babu Banarasi Das Universitytttar Pradesh Act,
2010
(U.P. ACT NO. 25 OF 2010) Notification Dated
12-10-2010
Babu Banarasi Das University,
Lucknow
'
I 9I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

SCHEDULE-1
(See-Section-B)
W new WWW—cits 31m, 2019
49
Si. Details of the Act Name of the University
1 . The Integral University Act, 2004 The Integral University, Lucknow
(U.P. ACT NO. 9 OF 2004) Notification Dated i
27-02-2004
l—Z The Amity University Uttar Pradesh Act, 2005 Amity University Gautambudh Nagar,
(up. ACT No. 11 or 2005) Notification Dated Uttar Pradesh
J 24-03-2005 ——i
3 The Mangalayatan University Uttar Pradesh Act, 2006 i-]:Iianga]ayatan University Aligarh, Uttar
' (11?. ACT No. 32 OF 2006) Notification Dated Pradesh ‘
30-10-2006 . .
4 The Swami Vivekanand Subharti University Uttar l—Swami Vivekanand Subharti
Pradesh Act, 2008 University, Merrut, Uttar Pradesh
( (U.P. ACT NO. 29 OF 2008) Notification Dated
05-09-2008 '
5 The Teerthanker Mahaveer University Uttar Pradesh Teenhanker Mahaveer University,
’ Act, 2008 Moradabad, Uttar Pradesh
(UP. ACT NO. 30 OF 2008) Notification Dated
05-09-2008
6 The Sharda University UttarPradesh Act, 2009 Sharda University Greater Noida, Uttar
(up. ACT N0, 14 OF 2009) Notification Dated Pradesh
24-03-2009
7 The GLA University Uttar Pradesh Act, 2009 GLA University Mathura, Uttar
(in. ACT NO. 21- or 2010) Notification Dated Pradesh
01-09-2010
8 The Invertis University Uttar Pradesh Act, 2009 invertis University Bareiily, Uttar
(11.1). ACT No. 22 or 2010) Notification Dated Pradesh
01-09-2010
9 The Monad University Uttar Pradesh Act, 2010 Monad University Gaziabad,
(U.P. ACT NO. 23 or 2010) Notification Dated Uttar Pradesh '
12-10-2010
‘ 10 The Noida lntemational University Uttar Pradesh Act, Noida International University Gautam
2010 ' Buddha Nagar, Uttar Pradesh
(U.P. ACT NO. 27 OF 2010) Notification Dated
‘ 12-10—2010
1 1 The IFTM University Uttar Pradesh Act, 2010 iFTM University, Ontkar Dham
(up. ACT N0. 24 OF 2010) Notification Dated Lodhipur RaJPut: Delhi Road
, 12_10_2010 Moradabad
12 Shri Venkateshwara University Uttar Pradesh Act, Shri Venkateshwara, Gajraula, J P.
2010 Nagar -
£11.? ACT NO. 26 OF 2010) Notification Dated ‘
_; f12-10-2010
L. T ‘ ' . .
13" ' The Babu Banarasi Das University'Uttar Pradesh Act, Babu Banarasi Das Un1ver31ty,
I 2010 . Lucknow .
(U.P. ACT NO. 25 OF 2010) Notification Dated
12-10-2010 L ‘
l9l7RPH_Data 4 Vidhaika Folder (Adhiniyam72019)
, r
50
\6ck-k- SlicqT 31RW-TRIIT quit, 6 31-11iT1, 2019
14 The Galgotias University Uttar Pradesh Act, 2011
(U.P. ACT NO. 14 OF 2011) Notification Dated
07-04-2011
The Galgotias University, Gautambudh
Nagar
15 The Shivnadar University Uttar Pradesh Act, 2011
(U.P. ACT NO. 12 OF 2011) Notification Dated
21-06-2011
The Shivnadar University Dadri
Gautambudh Nagar
16 The Ram Swaroop Memorial University Uttar Pradesh
Act, 2011
(U.P. ACT NO. 1 OF 2012) Notification Dated
04-07-2012
Shri Ram Swaroop Memorial
University, Barabanki
17 The Mohammad Ali Jauhar University Uttar Pradesh
Act, 2005
(U.P. ACT NO. 19 OF 2006)
Notification Dated 19-06-2006
The Mohammad Ali Jauhar University,
Rampur
18 The Glocal University Uttar Pradesh Act, 2011
(U.P. ACT NO. 2 OF 2012) Notification Dated
05-07-2012
The Glocal University Ali
Akbarpur, Saharanpur
19 The Rama University Uttar Pradesh Act, 2013
(U.P. ACT NO. 1 OF 2014) Notification Dated
10-01-2014
Rama University, Kanpur
20 The Shobit University Uttar Pradesh Act, 2011
(U.P. ACT NO. 3 OF 2012) Notification Dated
05-07-2012
Shobit University, Gangoh,
Saharanpur
21 The J.P. University Uttar Pradesh Act, 2014
(U.P. ACT NO. 8 OF 2014) Notification Dated
04-3-2014
J.P. University Anoop Shahar, Uttar
Pradesh
22 The J.S. University Shikohabad, Firozabad, Uttar
Pradesh Act, 2015
(U.P. ACT NO. 7 OF 2015) Notification Dated
24-6-2015
J.S. University Shikohabad,
Firozabad
23 The IIMT University, Meerut, Uttar Pradesh Act,
2016
(UP. ACT NO. 32 OF 2016) Notification Dated
03-10-2016
IIMT University, Meerut, Uttar
Pradesh
24 The Bennett University, Greater Noida, Uttar
Pradesh, Act, 2016
(U.P. ACT NO. 24 OF 2016) Notification Dated
16-9-2016
Bennett University, Greater Noida,
Gautam Buddha Nagar
25 The Bareilly International University, Uttar
Pradesh Act, 2016
(U.P. ACT NO. 26 OF 2016) Notification Dated
16-9-2016
Bareilly International University,
Bareilly
26 The Sanskriti University, Chhata, Mathura, Uttar
Pradesh Act, 2016
(U.P. ACT NO. 20 OF 2016) Notification Dated
16-9-2016
Sanskriti University, Chhata,
Mathura
.
27 The Era University, Lucknow, Uttar Pradesh Act,
2016
(U.P. ACT NO. 27 OF 2016) Notification Dated
16-9-2016
Era University, Lucknow, Uttar
Pradesh
191 RPH

50 WYHE‘SIWWE, 6 317m, 2019
14 The Galgotias University Uttar Pradesh Act, 201 l The Galgotias University, Gautambudh
(11?. ACT No. 14 or 201 1) Notification Dated Nag”
I, 07-04-201 1
15 The Shivnadar University Uttar Pradesh Act, 2011 The Shivnadar University Dadri
(up. ACT No. 12 OF 201 1) Notification Dated Gautambudh Nag?"
21-06-201 1
16 The Ram Swaroop Memorial University Uttar Pradesh Shri Ram Swaroop Memorial
Act, 201 1 . University, Barabanki
(UP. ACT NO. 1 OF 2012) Notification Dated
04-07—2012
17 The Mohammad Ali Jauhar University Uttar Pradesh 1 The Mohammad Ali Jauhar University,
Act, 2005 Rampur
(UP. ACT NO. 19 OF 2006)
Notification Dated 19-06-2006
18 The Glocal University Uttar Pradesh Act, 2011 The Glocal University Ali
(11.1). ACT No.2 OF 2012) Notification Dated Akbarpurr Saharanpur
05-07-2012 .-
19 The Rama University Uttar Pradesh Act, 2013 Rama University, Kanpur
(UP. ACT NO. 1 OF 2014) Notification Dated
10-01-2014
20 The Shobit University Uttar Pradesh Act, 2011 Shobit University, Gangoh,
(UP. ACT NO. 3 OF 2012) Notification Dated Saharanpur
05-07-2012
21 The 11’. University Uttar Pradesh Act, 2014 ].P. University Anoop Shahar, Uttar
(UP. ACT N0. 8 OF 2014) Notification Dated Pradesh
04-3-2014
22 The IS. University Shikohabad, Firozabad, Uttar 1.5. University Shikohabad,
Pradesh Act, 2015 Firozabad
(UP. ACT NO. 7 OF 2015) Notification Dated
24-6-2015
23 The IIMT University, Meerut, Uttar Pradesh Act, IIMT University, Meerut, Uttar
‘ 2016 Pradesh
(UP. ACT NO. 32 OF 2016) Notification Dated
03-10-2016
24 The Bennett University, Greater Noida, Uttar Bennett University, Greater Noida,
Pradesh, Act, 2016 Gautam Buddha Nagar
(UP. ACT N0. 24 OF 2016) Notification Dated
16-9-2016
25 The Bareilly International University, Uttar Bareilly International University,
Pradesh Act, 2016 Bareilly
(UP. ACT NO. 26 OF 2016) Notification Dated
16-9-2016
26 The Sanskriti University, Chhata, Mathura, Uttar Sanskriti University, Chhata,
Pradesh Act, 2016 Mathura
(up. ACT NO. 20 OF 2016) Notification Dated ‘
16-9-2016 '
27 The Era University, Lucknow, Uttar Pradesh Act, ' Era University, Lucknow, Uttar
2016 Pradesh
(UP. ACT NO. 27 OF 2016) Notification Dated
16—9-2016
191 RPH
‘icth At2T 313iTzTRuT diu1d, 6 3171-R?f, 2019
SCHEDULE-2
(See Section-7)
SI. Details of the Act Name of the University
1 The Integral University Act, 2004
(U.P. ACT NO. 9 OF 2004) Notification Dated
27-02-2004
The Integral University, Lucknow
2 The Amity University Uttar Pradesh Act, 2005
(U.P. ACT NO. 11 OF 2005) Notification Dated
24-03-2005
Amity University Uttar Gautambudh
Nagar, Pradesh
3 The Mangalayatan University Uttar Pradesh Act, 2006
(U.P. ACT NO. 32 OF 2006) Notification Dated
30-10-2006
Mangalayatan University Aligarh, Uttar
Pradesh
4 The Swami Vivekanand Subharti University Uttar
Pradesh Act, 2008
(U.P. ACT NO. 29 OF 2008) Notification Dated
05-09-2008
Swami Vivekanand Subharti
University, Men-ut, Uttar Pradesh
5 The Teerthanker Mahaveer University Uttar Pradesh
Act, 2008
(U.P. ACT NO. 30 OF 2008) Notification Dated
05-09-2008
Teerthanker Mahaveer University,
Moradabad, Uttar Pradesh
6 The Sharda University Uttar Pradesh Act, 2009
(U.P. ACT NO. 14 OF 2009) Notification Dated
24-03-2009
Sharda University Greater Noida, Uttar
Pradesh
7 The GLA University Uttar Pradesh Act, 2009
(U.P. ACT NO. 21 OF 2010) Notification Dated
01-09-2010
GLA University Mathura, Uttar
Pradesh
8 The Invertis University Uttar Pradesh Act, 2009
(U.P. ACT NO. 22 OF 2010) Notification Dated
01-09-2010
Invertis University Bareilly, Uttar
Pradesh
9 The Monad University Uttar Pradesh Act, 2010
(U.P. ACT NO. 23 OF 2010) Notification Dated
12-10-2010
Monad University Gaziabad,
Uttar Pradesh
10 The Noida International University Uttar Pradesh Act,
2010 .
(U.P. ACT NO. 27 OF 2010) Notification Dated
12-10-2010
Noida International University Gautam
Buddha Nagar, Uttar Pradesh
11 The IFTM University Uttar Pradesh Act, 2010
(U.P. ACT NO. 24 OF 2010) Notification Dated
12-10-2010
IFTM University, Omkar Dham
Lodhipur Rajput, Delhi Road
Moradabad
12 Shri Venkateshwara University Uttar Pradesh Act,
2010
(U.P. ACT NO. .26 OF 2010) Notification Dated
12-10-2010
Shri Venkateshwara, Gajraula, J.P.
Nagar
13 The Babu Banarasi Das University Uttar Pradesh Act,
2010 ..-
(U.P. ACT NO. 25 OF 2010) Notification Dated
12-10-2010
Babu Banarasi Das University,
Lucknow
14 The Galgotias University Uttar Pradesh Act, 2011
(U.P. ACT NO. 14 OF 2011) Notification Dated
07-04-2011
The Galgotias University, Gautambudh
Nagar
:19I_RPH_Data 4 Vidhaika Folder (Adhiniyam_2019)

WWWW,SW, 2019 51
SCHEDULE-2
(See Section-7)
81. Details ofthe Act Name ofthe University
l The Integral University Act, 2004 > The lntegralUniversity, Lucknow
(U.P. ACT N01 9 OF 2004) Notification Dated '
27-02-2004
2 The Amity University Uttar Pradesh Act, 2005 Amity University Uttar Gautambudh
(U.P. ACT NO. 11 OF 2005) Notification Dated Nagaril’radesh
24-03-2005 '
3 The Mangalayatan University Uttar Pradesh Act, 2006 Mangalayatan University Aligarh, Uttar
(U.P. ACT NO. 32 OF 2006) Notification Dated Pradesh
30-10-2006
4 The Swami Vivekanand Subharti University Uttar' Swami Vivekanand Subharti
Pradesh Act, 2008 University, Merrut, Uttar Pradesh
L (U.P. ACT NO. 29 OF 2008) Notification Dated
05-09-2008 .
5 The Teerthanker Mahaveer University Uttar Pradesh Teerthanker Mahaveer University,
‘, Act, 2008 Moradabad, Uttar Pradesh
- 1 (U.P. ACT NO. 30 OF 2008) Notification Dated
05-09-2008 ~
6 The Sharda University Uttar Pradesh Act, 2009 Sharda University Greater Noida, Uttar
(U.P. ACT No. 14 OF 2009) Notification Dated Pradesh
24-03-2009 . ‘
7 The GLA University Uttar Pradesh Act, 2009 GLA University Mathura, Uttar
(U.P. ACT NO. 21 OF 2010) Notification Dated Pradesh
01-09-2010
8 The Invertis University Uttar Pradesh Act, 2009 Invertis University Bareilly, Uttar
(UMP ACT No. 22 OF 2010) Notification Dated Pradesh
' 01- 09- 2010
9 The Monad University Uttar Pradesh Act, 2010 ' Monad University Gaziabad,
(U.P. ACT NO. 23 OF 2010) Notification Dated Uttar Pradesh
1240-2010
10 The Noida lntemational University Uttar Pradesh Act, 'Noida lntemational University Gautam
A 2010 Buddha Nagar, Uttar Pradesh
' . (UP. ACT NO. 27 OF 2010) Notification Dated
v L 12 10- 2010 . _
‘ ‘ ll TheIFTM University Uttar Pradesh Act 2010 IFTM University, Omkar Dham
(U..P ACT No 24 OF 2010) Notification Dated Lodhipur Rajput, Delhi Road
12.10.2010 Moradabad _
12 Shri Venkateshwara University Uttar Pradesh Act, ShriVenkateshwara,Gajraula,J.P.
2010 . Nagar
(U.P. ACT NO. .26 OF 2010) Notification Dated
12-10-2010 .
13 The Babu Banarasi Das University Uttar Pradesh Act, Babu Banarasi Das University,
2010 v Lucknow
(U.P ACT NO. 25 OF 2010) Notification Dated
12-10-2010
14 The Galgotias University Uttar Pradesh Act, 2011 The Galgotias University, Gautambudh
(U.P. ACT NO. 14 OF 2011) Notification Dated Nagar
07-04-20”
.1917RPH_Data 4 Vidhaika Folder (Adhiniyam72019)
52
th-t-(1 11c1 31711tIgui 6 31-71, 2019
15 The Shivnadar University Uttar Pradesh Act, 2011
(U.P. ACT NO. 12 OF 2011) Notification Dated
21-06-2011
The Shivnadar University Dadri
Gautambudh Nagar
16 The Ram Swaroop Memorial University Uttar Pradesh
Act, 2011
(U.P. ACT NO. 1 OF 2012) Notification Dated
04-07-2012
Shri Ram Swaroop Memorial
University, Barabanki
17 The Mohammad All Jauhar University Uttar Pradesh
Act, 2005
(U.P. ACT NO. 19 OF 2006)
Notification Dated 19-06-2006
The Mohammad All Jauhar
University, Rampur
18 The Glocal University Uttar Pradesh Act; 2011
(U.P. ACT NO. 2 OF 2012) Notification Dated
05-07-2012
The Glocal University Ali
Akbarpur, Saharanpur
19 The Rama University Uttar Pradesh Act, 2013
(U.P. ACT NO. 1 OF 2014) Notification Dated
10-01-2014
Rama University, Kanpur
20 The Shobit University Uttar Pradesh Act, 2011
(U.P. ACT NO. 3 OF 2012) Notification Dated
05-07-2012
Shobit University, Gangoh,
Saharanpur •
21 The J.P. University Uttar Pradesh Act, 2014
(U.P. ACT NO. 8 OF 2014) Notification Dated
04-3-2014
J.P. University Anoop Shahar, Uttar
Pradesh
22 The J.S. University Shikohabad, Firozabad, Uttar
Pradesh Act, 2015
(U.P. ACT NO. 7 OF 2015) Notification Dated
24-6-2015
J.S. University Shikohabad,
Firozabad
23 The IIMT University, Meerut, Uttar Pradesh Act,
2016
(U.P. ACT NO. 32 OF 2016) Notification Dated
03-10-2016
IIMT University, Meerut, Uttar
Pradesh
24 The Bennett University, Greater Noida,
Uttar Pradesh Act, 2016
(U.P. ACT NO. 24 OF 2016) Notification Dated
16-9-2016
Bennett University, Greater Noida,
Gautam Buddha Nagar
25 The Bareilly International University, Uttar
Pradesh Act, 2016
(U.P. ACT NO. 26 OF 2016) Notification Dated
16-9-2016
Bareilly International University,
Bareilly
26 The Sanskriti University, Chhata, Mathura, Uttar
Pradesh Act, 2016
(U.P. ACT NO. 20 OF 2016) Notification Dated
16-9-2016
Sanskriti University, Chhata,
Mathura
27 The Era Univesity, Lucknow, Uttar Pradesh Act,
2016
(U.P. ACT NO. 27 OF 2016) Notification Dated
16-9-2016
Era University, Lucknow, Uttar
Pradesh
191 RPH

52 Wmsmmwwmwmnzms.
15 The Shivnadar University Uttar Pradesh Act, 20l1 The Shivnadar University Dadri
(UP. ACT NO. 12 OF 2011) Notification Dated Gautambudh Nagar
21-06-2011 -
16 The Ram Swaroop Memorial University Uttar Pradesh Shri Ram Swaroop Memorial
Act, 201 1 University, Barabanki
(U.P. ACT NO. 1 OF 2012) Notification Dated
04-07-2012
17 The Mohamrnad Ali Jauhar University Uttar Pradesh The Mohammad Ali Jauhar
Act, 2005 University, Rampur
(U.P. ACT NO. 19 OF 2006)
Notification Dated 19-06-2006 1
18 The Glocal University Uttar Pradesh Act, 2011 The Glocal University Ali
(UP. ACT N0. 2 OF 2012) Notification Dated Akbarpur, Saharanpur
05-07-2012
19 The Rama University Uttar Pradesh Act, 2013 Rama University, Kanpur
(UP. ACT NO. 1 OF 2014) Notification Dated
10-01-2014
20 The Shobit University Uttar Pradesh Act, 2011 Shobit University, Gangoh,
(U.P. ACT NO. 3 OF 2012) Notification Dated Saharanpur
05-07-2012
21 The LP. University Uttar Pradesh Act, 2014 ].I’. University Anoop Shahar, Uttar
(UP. ACT NO. 8 OF 2014) Notification Dated Pradesh
04-3-2014
22 The ].S. University Shikohabad, Firozabad, Uttar ].S. University Shikohabad,
Pradesh Act, 2015 Firozabad
(U.P. ACT NO. 7 OF 2015) Notification Dated
24-6-2015 ‘
23 The IIMT University, Meerut, Utter Pradesh Act, IIMT University, Meerut, Uttar
2016 Pradesh
(U.P. ACT NO. 32 OF 2016) Notification Dated
03-10-2016
24 The Bennett University, Greater Noida, Bennett University, Greater Noida,
Uttar Pradesh Act, 2016 Gautam Buddha Nagar
(UP. ACT NO. 24 OF 2016) Notification Dated
16-9-2016
25 The Bareilly‘ International University, Uttar Bareilly International University,
Pradesh Act, 2016 Bareilly
(U.P. ACT NO. 26 OF 2016) Notification Dated
L16-9-2016
26 The Sanskriti University, Chhata, Mathura, Uttar I_S‘ansl<rit1' University, Chhata,
Pradesh Act, 2016 Mathura
(U.P. ACT NO. 20 OF 2016) Notification Dated
16-9-2016
27 The Era Univesity, Lucknow, Uttm Pradesh Act, Era University, Lucknow, Uttar
2016 Pradesh
(U.Pi ACT NO. 27 OF 2016) Notification Dated
16-9-2016 1.
at( 4iv1d, 6 311TR?1, 2019
STATEMENT OF OBJECTS AND REASONS
In accordance with the guidelines under the Government Order dated February 06, 2008, twenty
seven private Universities have been established and incorporated by different State Acts. Since different
Acts of different Universities contains different provisions and there is no uniform provision for
monitoring of such Private Universities, it has become difficult to implement and enforce the policies of
the State Government, to collect information and records and to implement the standards of quality in
higher education.
It has, therefote, been decided to make an umbrella Act to govern all the Private Universities
under a common law.
The Uttar Pradesh Private Universities Bill, 2019 is introduced accordingly.
By order,
J.P. SINGH-11, _
Pramukh Sachiv.
410RIT0ZL0410-701:110 191 1)111-1 —0t40-2019—(565)-599 Aratit—(WMEL07/t1/318:54e) I
4t0cRi0Z01071 04310 68 TITO fatTRI1-2019—(566)
-300 Ard-81—(MTGEL07/ a/ 3178tre) I
19I_RPH_Data 4 Vidhaika Fold (Adhiniyam_2019)

Wmmwmwm, 2019 53
i g STATEMENT OF OBJECTS AND REASONS
In accordance with the guidelines under the Government Order dated February 06, 2008, twenty
seven private Universities have been establiShed and incorporated by different State Acts. Since different
Acts of different Universities contains different provisions and there is no uniform provision for
monitoring of such Private Universities, it has become difiicult to implement and enforce the policies of
the State Government, to collect information and records and to implement the sténdards of quality in
higher education. ‘
It has, therefore, been decided to make an umbrella Act to govern all the Private Universities
under a common law.
The Uttar Pradesh Private Universities Bill, 2019 is introduced accordingly.
I»
By order,
J.P. SINGH-ll,
Pramukh Sachr'v.
m
mowoqoifio—thho 191 W—(fiafikzom—(sesysos m—W/a/mn
ii, ' mowoqotl’tojqofio 68 W0 fourth—201s—(566Hoo Wei—(3751213? / a / WM
‘1 y' V . ,
l9l_RPH‘Dat_a 4 Vidhaika Fold (Adhiniynm_2019)
t

- 00000001
- 00000002
- 00000003
- 00000004
- 00000005
- 00000006
- 00000007
- 00000008
- 00000009
- 00000010
- 00000011
- 00000012
- 00000013
- 00000014
- 00000015
- 00000016
- 00000017
- 00000018
- 00000019
- 00000020
- 00000021
- 00000022
- 00000023
- 00000024
- 00000025
- 00000026
- 00000027
- 00000028
- 00000029
- 00000030
- 00000031
- 00000032
- 00000033
- 00000034
- 00000035
- 00000036
- 00000037
- 00000038
- 00000039
- 00000040
- 00000041
- 00000042
- 00000043
- 00000044
- 00000045
- 00000046
- 00000047
- 00000048
- 00000049
- 00000050
- 00000051
- 00000052
- 00000053
- 00000054