0.4,Tizgri-79
#'RPR 91-43—R3foRriioto/kWio-
5cc1,0/ kT9o1n 0-91 /2008-10
the te cp-41s1ie4
kirif TibT
Tff( tibitzt titcm< ZRT Talibff
317iTairiuT
tiPDitt
(w)
(‘311' wa-zr aarrizim)
Yii)ciff, 28 ItroVa, 2009
lb-TFp 9, 1930 -Vr6 wa‘
.i-cpr situ tvorw
ffitiRit 3iTir4-1
ti,e.Rft 493/79-m-1-09-1M9-2009
c1sPIth, 28 157-01, 2009
zar-iF9T
fa
giti Th7 TT31.71-4q 200 31t1)7 AILI 171 ilt-Ca aCCI'i . 3R41 1-Mt
ffralicitt M-cf- , 2009 tR 1iiCi, 27 1:677€1, 2009 .4 3Ft:A 31-41.9 4 3113 .4-6- wav 34fOrktITI
TI-C411 12 WI 2009 t WI A -il-thilITRuT '09T2.1 Tfi 3aRriT giO Ir41:4Td• Dim •ificfi I
ITtir 317-41 177# RZciDtiiciLf a, 2009
(\i'M 3TaT 3.13tr*Pi 1sJ1 12 TFI 2009)
1 1/4;1\1rJ1srk1ftw9 iluScf giO 'eta pil
3T-41 3fri ih7T-4) 414T34 A ftE-44alv argtur4 t ,iccNw-a-ir 3Rif1 t5141
14scatzeta 7P-4441- M ftrrq zict4ti cm4 att7 wif4 31TErfkra trt th4-41 ml um-an th-RA
3114MTPT
RTM iluNlva è*11C0 74 Af"IfR4cr S rota uliciFt:—
3TUTTEI—co
9r9 1— ifg 31W1z111 3-M7 3R-411 MIT41 feTafeVicitf 3alfral1. 2009
pRui • • th*r
(2) wizr 0,11 1 -44 Tiny tkok A 3TRII,T4•11 gii
frizra w3i

111111111
11121L121131191m1192111m1111gu1121£fm112$11§11111(z)
11111111£ 1&1; 1111111111
6002 MW ngg} 11112111111191111511111 11111113119 9.111(1) -1 1111:1111};
M1111
111—11111:
‘3%WWWWQ§EW$MM
11111111119
1&1wmmgmgwfiwmwflmwwmwgmmmngmm
11111911111191111121111aa mw$m11£1e1uem1a1g111191m111111n11191¢119§11
[laiagmmfimhmgmmmgl
(soozLaZLMWRgtmaa)
soozl'mgmmwwmm
@1211ngmefiwwwmgmgmozmu111,111
unugwmgumgwwmghfimgeeooz wammeooz 'mgmmgmg
11111111111111.11111111111111111211002113111911.mg111122111.
KW
EEI— .
sooz 11,111.11. 92 2125111
‘ 6002-6(5Q)L-60—L-Q1-6L / 26v 1125111
1—111111219 112mg;
1111111 11111 1111
. 1112111 3111 0961 '6 131321.111 .
5002 11111411 83 111112111 $111512
(1111111112 111—11 1.111 "
(93) 111151 '1—11111.
11111111111311
10211111119
11151131 1112 1132111 111161111 11111
31 MM 21 21111 25. 111115111 .
ot—eooz / 16-011mm) #9122
-°1£h/ 0111011110111—1211: 1:113:31
0
2- TiT 3TffiTh iWri ffi7F?i7i A 317421T 31q(hT 7 14-
-reVI TIR40.'" 'VITT" 3T13 Tfttfq" m ITTT:14 fasra-are:p4
Th7111.: %AI cftt, 34211 3113 iPJ trittR 31 5;
-3i-4-4 wartaat m.4 urerzi il311 3i3eir 31 ,--41 $-34 31fOrtitrq
(Srearaia44i½ qft ½ 37133T3 1-4mfatrwzi vi}
ticisc ;
..-fwg-e[ TItatfiffT c57 11343%11 t1 TET1 fesqffivr-44
gI31 Afremr ITTLT
-Tat Th7 TTT171 ThVeT7TT-631 37TTRE t;
,fa
faraftalettf Thf tii,11-74T71- (TT TIM OVA !all) ThT 711044
MVT31 tit) 404 0 t iI 101-4117131 14731 1410TI w7171.6j
AiTr 51 all-3 IZTRIA ITa9 -emu 3FT 3TTE7-05 Pl&Tur aiti32.7 -0; '
.[7-0WIT-67.1ci -1311,11-0171" -‘61 cm.94 b51,1 nofil r ck-7
Th-413:1 *clq '34 -5 -A f4scifav1ett4 brr3t 11110Tt
ART -4k TTT TE44 1 T6Tici TITiTtTIFT iI 1.31TETRin
TRTRIUZTTitlftrall*Esvil fka433 icl
(2) "Itta- icr uktid trftMtrrA iV1 ff -a t1;
th911 tio4, tit:Tivr TT 1.4eth 7.41Tthuc4i1 i3174-41 A
urperzi 134 Traft-uTati 7119 t;
"Vit13.34,VI tFPW tt5T ofcgai 1JW fa911 3-7-rrei ti
(io) -713fitzur. -atairtzt" 3117 -ffen/P1's I5T Th7f7T: 1:*frazirazi
zi trfazTA, 31afft7f 3117 W4t17 t;
"31t71TTTh." TTTT4 34 741 IdJUIvi 1
717P-T17 TT Wit Lica), 1-11.1, in TIT-1M TitIlf401(14
lbTfaTaTat"' ThT TrecRi uT31 3 3Tal itufga 313-.11 tb43311
farofrarmi 34 Si
3Tarrzr-r
l qIciieiq
fastfroranml 3- (1) C1STi 'actN cci3 rthr af41 51 thwfkrralf, -4r4
winvn
nn ffinnn 74 \TVftreCelregr Wrni Vet VII 01 I
(2) ittard71 -) RP! ci tITTT
favenizith - 1.4c1143nati ttii \aqaul tpl,U V34 ar41 cei mm11 wqi zRIET3I
T-tr4vn Rt 31134T417 UPI 3. 71 STT1 srd 7.17NT WC2,1 chi-fl '61711
DsaDirern oil did 5-faVe4t/Tail wf 31-1 tizT 14,723m f471T 31111 ti1W-T1 r8e 541
3fiR tit] Z 91 %--t T33UHF tl Wit TTT a TO 9t1 31/1311 7411177 ft5 fa”faCTIF9
iu far4,14 ite-Tur Ingisnit A zratrifta 333:szli aiRm 33.5I siNt
3TeT
trv1 9T34 awr gzufavicizi 39-3ftd raiR0
312TVE 9171ftel t 3171 1tP4 0111 T1 91511Th 111 M ft tWIqv4-0
741 3-1*141
FawAtnan YlizaTtli 6- faraViall 5fi P fl1Rd youtri wned-04 "6171, 3TeT:-
Teri 4) ca (1) Rtir m`t ncrai k f; thwftar-gzi wrn-
A fteivr 4
1032 RPli Sa.Vidhaika_pata 1
'1.

31:5" -1
WK. 1 -
‘ [IRWIN 2_
’1
' 1‘
1
.I‘
l
.' ,
’ i
3 .
a :
1 E
I.
I',.
15:
l: I vi“ .
1‘ V
)1:
z 5
' § 1
'i5 :
.' .‘ I
P i
2' i .1
1_[ ,«r
'1 Q
1 i
:I'
1; i.
_E‘- -j , finafim a’fl ' 3-
I“ warm nun film
95"
' ' mammal! a?» 4-
i! . 3132311
'1' Raummau {rm d'fl 5_
i “' 3m u‘u 23 RN 3m
11-
1 , [375951312 3% mfi‘fi'm' 5..
' I i ' nan. win:
if ‘
1032 RPM Su,Vidl1aika_VDaxa l
331 3113131111 1‘1' m am f3; 31751111 31712113131313 =1 3r— ,
(1)'f'3u1qfiqa“¥n'1r'afir‘cb1d 11mm" an mat! magma “Eh
mimfimqfhaWHwQWrzfufiwafi‘b‘ '
1'
(2) wmwrfaamu' wwfiflmwai! sfigaaxffifimfl
5' \
MT In Wall a‘a qfifimtfi a‘> 313w? [azafaarau
m ":3,-
(3) 'wg'fi WW" 2131 armi 33%) man 3) ‘3 Uh 3321121211313:
gm 111-11311 W 31-,
(4)1th W aficni 13371133113111 :3 mm 3 3,- E
> F
(5) Warm 251 '51?! 133131" (In 1131133416111) 251 amnf 2615113,
1)
WW 35" W 3613 3 3 Uh Wu Em HERE: ur ’"Wfii’
cnra 3‘1 31?? RM? mm 31211 W 31311375 [312M 3%) amen 1:); 3
(s) f'asafh‘wa'u an "1313113131" 2:71 maid m Ham 3 (3:1 W373
(E i
F ,1
g:
fiamafififis‘cfiréfi‘é ufiffisafiamumlmmmvm»?
311121331211 Wmmgfiwfimaummamm m-j‘
Wwwzlmmu$maTfiflmvafisw433
(7) ”W33" 251311111 qfifimfi 21111313331 3 1, -'
(a) Mmmfimmwmmzfiwwfi ”'umtzl m"
WW WW :3 war—1 3 3 1 ‘
(9) “(13113371 mam" an arm} 1326192113103} {326) W11??? 2‘; 3
(1o)'ufifim1","“ala113w 333‘ ‘flfiml' 371(an Wm: msafaum
fivqfifizm awfiwsfivffimfiffi;
(11) 'aawm" mamfiéfiwfiafi3’fiffisaffimzfim‘
Wmfifihm,mmmrfimfifimmf
31;
(12) 'fififfima" 351 mad am 3 3 3129-1 32111331 3134) mm“:
W 33
awn—3‘1
133313311811 .
(1.)maw Wfififimuéfimfimflffiwmzx «B1171
finifisafimaufimlfimml a?
WWWQHSHWWEWI
133:qu Em {13331 m7 213 3?; m1 321' 1mm 111m 21% {31W
qa’sqzwrcmlamafi mwwmwm-Imaml
fiwfiafim anm wa‘flWna’cfi fir-n'wfi mfimfi 3‘: RN 337“
Fob—fl 314 um 21% 131151) am 3 :13 331' wen Gnflvn fis (Mammal? ‘
mfififitmfilmmfimmfiamwfiamzsmufifi‘}
Wflmfi?
mamfiafiémfimfimauflWwM-L
awwrfififimfifiwfiw‘flfiuflmaEWf'wuwfl
311131313313?th
Wamafifimfimfififimfimmififi amia— Jr
(1) tamaamwma 1314mm 31313131113} 13mm
frT
ctlq1 chi-11 at 3171*IFT MT 3TMEgtt4 SREN
Thfirci Wciff-11 chi•il;
fth--41 Tea Elicit( Th4 i1lf441(11 1 111.4111 45i thiit1IthcbjWe.;71
atl-z toicgqi Tiwgwi 71-61t -ara111 mi 1117kt9 Vrivilnu
\i•ia qffilir Th4tur cM-11;
31-Taal, fttab9i314 MIT 37q4 tlf8 f&P.rtiz.-4ijft iPgr
7-0 vailt rf- 7 T 311-CrI•1 chiqf MI1
3TRT S Thlite-er rAt-ca 74 C114-17
ffirl-tA lI1yiei i fr ft-t tito 7Tui1ur-dti •tf
tic4,5 ii6iRviet4 aT2T4T 14)-{11 'R1311-thl 1113-AUTM.1
fOt t4Iqt4n i5T 3iz24Zr9 fi1flir -6);
(-€) f4raf&vicia kZI1 th44ffit5R-R4TI 31 Mftai
TruRr-dT MP l, 14-ftflzilli MAI
3Tarate 14 Sft-a VM1 3Tth71 31--VETP1 cpid e4RIT
Zn
(4) ft- 4 qjti -Rt, tifay-Auk-14 a)-
Ole{ ft-4M cfr<c& ff1911 tfll 31U1119 1t241 g, tz
q4 7m1 311t9 i0 un mar wrrasil
340-- Rm vtiq, curio &lath 11W1
gjv ff54 4-4 b4: IP"
(17) '-iRflwciThzu atuutvi 1 a40mtl vr-di * 31017f
YU WWI 4 wr f1941 Tfail-9. -41 tiect) ZIT
Utrziwr Hs114.4ici.0 4 TIT 31'tf %Elul Ti-tarrs4ff 31Ezni45
4t arRi m-4401 t 3{zrar mn4 -cr6R z fto fa4Pr
3ti-R11 Tut ft4f* Thti altat 14, att- 34-d
4FI4M'i ru 3T6711-4-414 14 3Tfm-fOrr snil 3T019
trilt Wci 31aftf9" %-zil g; ITT
(3) 3fri 3I-g g 3tYR laftl?r-ifr4 -02.1f
&alike &REM-RI-a Tal am114 crinvuicr vizil artzpa
%LIT g; TIT
kerff 3fri 3rg g 3417 Mi-b 1113144TP um
34Wite l't 34RaU rd-T 347T atemtf WET 31t2111;1
14,t4r t
7-4 urnyr41*.f7, 1T 3ff211FaVIN
31C2R/9 Th7R1i t , tItaitet 31Riffft chi•11 3fiR -\374-t,
Parea-ara-4 c1 3qilI- P-4-r9 cmir;
t43f4zP4 4 3TRiaff ftf4 awc 3407T TI19-4 31Si 3TP-MI
3r-41 Rut ITT4-41 taf3itco1 cren9
4kalfatiql' a a iletara-n -a"; 13-1- i. 4 ibtair
311 wits441-ti ituat tzweii 4579!ii
aratfta Thl;
WTI Rxafacficiql TITRim-Tal4 tRtt MET (NI
f'aq Tr-gm-Ri ITT W-6-titTT chilf flita-̀ 34itaiN-0 31dETIRd w4;
1332 RPII Su.Vidhaika_Dzui 1

311111113fi3131113131111m$f113ama131$131fiqf23fiq1n1
11111131331111331;
'(2) @7111 Wmafimm 1111131113111111111111511 511111
mmmwml 11311311131111 an Twigsh 1111111111n
11311131111371fiu31311>131;_
(3) 311m,1%131111131131113131 1111311113113111211‘111'11111111131'
(4) 111611111111131111311111111311111311111113 15111 11111 11331111111111,
mmmmfimm3dmwm:—
(a7)fi1fi=1fiwfiamfimfin11mw®um1m
Wmfigfimmfiawm—mwwnmfium
fimmmaanmfimfifin
(15) W 11111111111311: 11‘ 11 11121111211111 3111 1111 1111111
mmwmfimmawfififimaw
311211111111311161‘81111111111311fi33131111r117111fi1u111;
m
(11) 1113511 111111111 311111113 13111131113111 3‘: e111 11’ '111 111131
I WWEW,MVWWMHWIB13111
vhfifihmfa§31fi33€1§3713fifim1m131121fi2fi
13193193311113 1131131111111'11‘1'3 mfif'asafiarau
gmfifi‘fiafirfirfivrfifiqr
(3)313Wammmé1fifiaffimmv13nfln‘
WfimmflmfimMmmma
mWWfimmfimemfifiaM
mmmfiawmwmwtfifimn 111111111
111Td1mf911111§13fi111111131fi151111<1111131811 3111
WWfimmwfififiammfinsflm‘MW
Wmfimmfi;m
(1) 11111111111-1131‘113111131111131111111113111211'
WfimmfimmIWWQMW
11111181111
(11) 31131133131183113111111—171311111111111111
31911721111131Wa11111111311fi'161fi1111111331131wu1
1111111111
la (5)®W$.%3.Wufifimfimawfi1fifimma
‘- 113131311fi113111133f31m81JT118111131m1fi111msfi1w
Mmfiwfimm; '
(6)1fifimfimfimfia11fiammfi111aefiwwwfihmmm
31111311132111me
(7) 11111111113131fi1fi1fi€11ma2m381 Q11 1111111111 11:11
mmmfifimmfimmafimw 1121111111111
:1 fiafiammfifiafifi
If , . (mammawmmm'mwmawwmm
a 1‘ ammfimmmfififiafimmmfiafi;
i 1032 RPH SlVidhaikItDEUi l
4
\i'VN TaT 3ffifsff79T I'4 d, 28 9ff7-4711, 2009
Fas-ofotir-T: aitiMmit
(9) Ycl SlIdtf 9N1 3Tea aTairq7-q
-q't
IT-41 117 cziraoct fleavt
(io) 1§1,1f4-4-riz A ftazur a4*thc 3T21Trr4 ct it-ticir 'in; •
(11) a-dill ti4,gcn zn 41n-z4cn u1-4,01 .u
aTh
J 341444 cr,
tpia_TAzi tR12.41Z110 gRT ZIT 3F4:12.11 3TEFIT
V Thnt Tet tk;
(12). iaP1-4zi.il u2-z1 &Taft&
34ThiR tn,ccc1&iL aTtn5T-4-tzn
azisn3-qr-wzrf 1.11 g), fa--arPznji
-RIR-2m cm-n 317 ‘34 144I-f ctN,11-;
13/1 ir4gifit714TtP1,119N4 •t4R-P-id ivu
ch I an-R•
farard-CTIFZI TR-P-T191 zfr ut.4, ZIT t14•Ei4 TIT *iwrk-r
Tisv -*f9 f4-qm 7-Pa-r-ft z th-gcn ;RN
till thcl-e att3-TRIMT mindr
VtCI cfN-11 t 3101-(
f4zrd fd 1/441Q -
(is) it raitar-dzi, --ztztzR 241trz-
t14-cl4 T isccf T Icth rtil
f4n-R1 7 zrztaszu-r uarr f4zOur
at)- w9-14
3T-grriT9 MP/Ad CPdI 3 &lc?,
'al-47%ff ort4i;
(16)1011,6 1+4, ed-fi4T Tag wit 3T-1 31
-TWITh- ITO 71-a9- '01I
f41ZoL41 4N-11- ;
(17) .4gt m-rzl ctroi, tog -
07141 Tre4TIM 31-1Ten- /Fr
-0, 4 Sr .1cannt
31-1-273R M ff,f7 311)-1
z411ind4 31Rr4ft
3ilt4,Yr ut4:-
(). T-a-rRIzrr6' ;
(ir) aTf44q1 ;
zr- zr ;
(f.i)
- (13) t{1 az:r 31-PUMV ft g-
RT 14Ze4-alc,10 --ct)
1"A ,itia
s- (1) 7111:11-F fSr5T
.sa-dttrit tP ITs azt-T4 zrn
antinz
itrecarF7•1 M ;rum -ffazr TRH ThTTni
-rqf E)A aN. 7)14 lrbr..
1-7TT 31t-4VF9‘t 311-R itrclinlicil-f
zo4-a ST-g1-9- cf,;:r
SM)Th 43clifb-Lta- The)
31.92, 4
?rn,ntit9 tzn
-4:5rff zr! cr, "ar 6
faa-c911 4>) SRI
7,1;;t4.1t 1--# 77FM-it 3tfid, f.;-t4 ch,e1110
- 1TJf .971
Th-‘1

_. “Em
vaE E: 259. .wufl .3555 E 5:er E EEW
WW wfi FEE» mm pmfiflwwfl & 5% BEN wk mm firmfi
. . , . 5% g:
.% Em am gag HE E E E HE £5 E? 3.
MA Erwlom EEK» .5 E;
Egg] 5% w. EEE 2% E55 2% E E % FEE
Awbwfifiwfigfifigfimgufigbagflwu
3% may E E Eu. Em @559 E am mmmwm EEEV 3 1m gig
, £5 E E6 A _.
.Eeswwwfiegefififiaufiggfig. A ..
A. U 5% a. E E
_ NEE 5% E
w E E
u E5 EE 3
u E E
“£559,va
, PM
Atfiamufififiwgrfifiwfififigfiflfifi
AwafigwmgfpfiiwgmwaEEEEE
A EWHEEEFVEWW
“E 5%.
”Q pm Em 5% 579 Em 3% mafia _s E
fibgoEEQEwgwquEwflfifififi
E? E. BEEEEw 55E. ‘wfimflfiflfis
Ewfiflnwwfiggfimgégvfiggg
“EEKEEWEWVEEfiE
fiw%.EEEBEBEEE&
%_E£EE%€E5FEMEAE
Sm Erma Am 5 E5? E E EV
EEEEE AEFE Ems an 3% 5 Egg E
”mfifigfifififi
Eggggfigfiwa WEEEEWE gm
5% raga? ggEBEMwwambEfiflfisz
LEwE.%r§§5E%¢wE€aEEBAE
“Eggfifiéagfin
gfiwggawfirglgagfizggg E
83 .E mm E E0 E E v
igge'
kirk 1.15YI ZijtjNNUI Te, 2 tr<cifl, LUU9 5
(4) ,wmfecrfa 0 4th 3P74 71%71:41 b Tfi 3TRIcktI
4Rf4-aai gni R4I ‘3•Tc4S) Nag SM9Thei ‘7iTg
9- (1) 910919 tbalaviciu an 31145lt tt9T 3t7 9./.1 •
c•t3e1014t WT ZTf1tfW it 3) fkgayr %-ar wain frima>, 414
UCTZTRI (2) winch- 31-174? Trthu TIMM- gpo WiTt Th)-1)
TIT.) I
3#111.9. T1" .ftf1-919%-9 99'14 tit 3T2na:-
(T) Tel ( rl. fMrat11-671, wrn tm Wrgail
91 TITATTg Tita-CITF-11 312491, 9I,Iffmr3 T1T 31910131 3)
3TreA49 tl) 14ain 41taa gkr War rin4r
(4(14R1 trarafti warftr own wer* wa 1-4
iTi-99. 9°1 1- 1331 3?I 01 3). Th-Ti ;
dWIcilC 31,4 -914.11c141 TIC°4 11111TRITTI% g 9PT-iTTM19.
TN) U11:49, 44 T37T9 -91141e114 5T-914.49 ref t 91 TOT 19; 3113'
(71) T,F4-4ci% gkr 4rafff-,Tz [Tr!, weer 1tAfitf art
41 ,i1;
4r-gl c4 Tatra R3rq45)
fai-q7i cM T1 &umi TOth t, 951 cri 1 1:419 311119-(9)
34014 31a-4 gkr V4419 34N-T-99 (TT V-Titi
0 99 11 9e40" affil10 tr,;(4 A .44-1kf@z m-44 i
3149T3T (7) 31EIFT 994a 31419ftf 9991 119 MITI * uf,
9),919 M TR A b44 RWr opTha aarrsiaa m-4 A 4,4
'1I Rrf Ø3413 W9 011 th. cipaITTit 919 31994 9114 3DR
N vita- le4 ‘111‘7) gia thfilifftz vti4. Af4fr?i
• ce,c11 4ifa &TT A wrt `?171 arm aT14- A 3TRI 434
wf4uay t• 919 Mipt• clAth dr ..m;Raffi- tra uRia m-z4
.314,gctrf I gife T,F1-104f0 949 IfT19 ThV PE1 it111709
it aint1C41 A A •cra- -211io .v‘2.41 31R4
ffiil 4 , 3#419 f993-19 414-at cif'Pg 4-4
3444r4-m-rr \14<1gcr 9 ct)th 1 •
(4) ,rei T--,FrfOtrft 3:rf4 gHT Rrubiftst 14,4 wWrai .111
wf4yr aril-at e1-zin 71-FT wrzin 4ti
9419 t 31991 RN) 1 RY1 fL-1.) TR) are4riT4 A A iii Tairft4ai
&fro Neef Wrd-Cti 7 Li 3th .TaTittn 7) wayi
<..-a 34 Th7 U1r4991 99) thirtf9 ef WU 9) TO Afin
uatuRT (3) 4r41 4 0 cR-c-7 0th 0 31991 1.113
TEMT) 1 '
if Aftrit zatirir (3) zu utrEair (4) 4 Thittz ftqft• .gaii-oaro
gio fa141& 3rat1 191 9P1 m IOTT9 t.) 344:4979
343TTTO t ZIT 311Th W.:641?Pira 3-nit TT re14)11-49 if..-1) 99 99 919
cricli 4 A f. 5-+11 kg, -ar 3TRUfi J51 ticf f41399. 'W4 KarA 41/2
zazjagr 4f. f thapa41--;1• firm A afWdo
a4%-i-al 4& Telt) Ptg9VI URI (3) $ 3p144-3I11
A fe4 Th-T 9111 IMF WI I
7iffilt icr44 TIT 47.1-Ent claci i 47ur aTearn7a thci
w441 (i--:-(44 tf 13W1 4 3MP1! R54
1032 RPH SiVidhaika_Data I

531 $5 a Emma 5 E1 E, 1," bag E é E15
aw Gr. 35% .315 Wm E Exam 5 mfi 5 GE»
EPWSFPETFEEWF
swig ”m 3 Em ab fib mama flaw. in my % EB
"2% 113% wqu@ firefly. E m Eu» rm.“ 5%qu
$Egfiagfimfiw§sfifiéfpfiw
ngngEEggggsme
SFErwwmfiWfiErggwflwswfififlEm
Epflilwmrfig WEEmAvV EEWEE Engagfiw
.mwigfifihmmwufivfifirwrfimbafifigg
qggmmfiasfipafififieagwrfig
Efiwegyfifiwgwfiwfigmes
5€§_HE:%€EE§:E.
mwmgmwfisggafififisésfi
fiégrfifiagghwaEQEugwaéwwE
Efiwwfiflwuwgiwfls
Ergggefigggwfiggfla
§§.Egfififiwmgfigafi
grgnrmmrfimmwugfifiugfiwflgfifimg
wEEEgEEEeEEEwEB
ngfi@»m¢B@5%rfiwfi®E.fiEuflfiafi
gg‘gfiywaafifigfifiwpfiwfi
gnawfizasfigggfifiéfifig
Egggpwmfififiafisfimwwuwg
gazhmmwiflgfiwafigflfiwurfizfiggg
Eemwmangnvgfiaafiufiguwfifi
5&8 Bu EMF, fibflfl gflfir EM «a» £35 %
Ewaw gag E .m. Ev WEE c E Eva E
5% aka EVE», w 5.9% Ear E E5 PK.
”Erma”
$55.5 E E cm EH .3 wflflér E E E
gaufiivfingWEWEEPWmfififlflg
wart? Eggfi EEER EHEMEM E
gWEEEcEwgfimg
réwflwrvbfigszbfigfiefigfigv
m.EE_PéEmEquEEE€rEg
”y EEWE 5 Egg 1535 NEE? NEW 5
Ema» Kama? Fab EBE Engage E warm mm. E
1535 .fim E FEE rm}?
rpm?
WépmfimerufifimmflrEfiEfiEng
Erwtecpwfifiémwmawwmgarmsfifineg
mm 1,12% E Ema @159 E E35 Erma
EErfiEmu rfiEEEEMrEw—mfiu
stageswmwwfiemsfiwgfififiéflfi
{I'LJ .
$3 53.5 3. EV: §ZJ$§ Eu: :5
3 1m 1%
3 ,
Ti 3M1}-TRui 1Iulu, 28 Th7qt, 2009
)2fifr l,,;r!
(7)
var -Tc-4 194 ff,rirr itffr* Tirgru 4
irg 141-5 'r4fbi zw wr 6cbCk •165T ITJ
M cclef 3.TTzzjfbj Tn iclit 1:1-qci Fitsf4Tr ffic 34-6
ir fair4- *Ha wi 'et sw-vr Met Zi;
(U) ctrIL1 3474 tR Weir ("') Thct Uft ati Thcl 3104
ITZft trq ZTRuT ch II;
(TI) 42,04 , ffi39-4 ItIcI 71 4 am/ wvr 9 4 *.r-r WIT
aT-q-14 fR f9-gavr wr wcbt :
cr3crALIRE *14-6Avt 3tti 1-6--errarRvr
g crocit apt9r tm Tam Tr-EAT atY- 4etarc4th
clII-'fl 937 V ffi-4 ,414 q6 3199-r trq wur (N4 t
Miff WzYTIT I
(8) 3TR119119 3iFett 344r9 '46 q, tQHRI 4 wcrailtzri.
u•ar ,Aur ar--q4 7r4 v.11 gfr 1,,tr ‘9,4cok ,emikui ZIT itAq
afftsr gii i mftIM 31-0WFfta c0 I
(9) tc-P-Ira .<11/474 qYcIraelidtf 3TRIPZ19, 1973 Th1̀1 bINT (33) i3aR
Tredu -14,tft it(44-11 ZIT 9ftrzr ftRr wrzrk 1I 6cr,K 9tvrr :
EfT vier fist fazqi4lciZI 3T2NT fS-44 3r2-1-ar
ITElfdtitall Th7 eV 311241ITT 3T2NT 3TRIt4ia ctrItIra
f*trr .11?) 8- ‘3v4 \itr a f4f4 A ftprpr Tru 34441-m t
3TWEN ctr< •<64 Met aTITEM t41 3117 1axcI11VId4 7T 3r8qT9-,
ti *IT clq, S411 rvitf WRT- ria f4W 6)4
3tZT-419 4McIl '46 I eti
(io) fs4 tiftfterfaM A- ft-4* Rcirrh-r 51-) t 9r1 „
1- uilzrcr) te44 p,criifvfZr cgclifWa. 111
t 3PT%iT tr-crait Tw uhir far3r4td
. ,•„
trq LR zko?r m-7 Tr44:-
(m) ciptifa Th-T le:St t 3 tcI'NAI
14q14 Thar *1411Rd a-T-T color Rqvr
uiiA arzrar \31101 Pqvr. Ortr Trntrur t. il e-tra
cgervacr gr4 ,r,rilata- iMT-vr wrq-41;
(u) ut5f qier4 Erg Rqvr viir) .ta waTTRT 0) i1/2
(5) it zmr-q-44it 31T117 if4}1T 1T .311ENT tf INT TIM—dr
et;
(9) 1*-4t & &gra ReTft
ctriALID WNW]. 341-9 cgclq TR TR
it-dt arf4ff itt1=4gf4fric Er-a-a 4-vmo-viri4 4-4,1
**1 vrm-R itt .Q4i Mr 4 ctrt 4-4-r-414
tef 31-Ttta Pim ara t Icrw -44 4,
S 9 tr
(i1) i5N cit fbi 31:1tTRT (i) ZIT 31:IZTRT (5) ZIT kiLltINI (i0) it31V
,
1 10 tt 5T itZhIR 9 fAr ff4
farcrithrazi '4t5--dii awal, croLD
m.49-r I
lift -43-arra
itt 3Iti tida 171 3IWZFE
-,Fruffku 9-11 ctr<vir irr mitrikvr <rr<4
(12')
I032 RPH Sa.Vidhaika_atta I

~ Sdéxuémsvgdm :5— N8—
EwEEE&BE?EE€E5m
wEEEEwEwfigfifian m3
mung
cVEEmfiéEmEEEEE
. .Efifivmfifibflgpfiwflg
EEfifiEEfiEEEwE
®E¢EEE£¢E%E
BEEEEWrfiEEEEE E
tfifiggmflwbwufi
Efiwflflaggwfiwflflgwflgwgb
@EBEEEEEEEEEE
EwwwfiwfiEvagaflarggmflflEflec
fimvEEwwwfiw
«EEEEMWEEVEEEEVE
EEEEEKwEEGNEEE
.mEfifizmewafliflrwmfimfifibg
AEEEEEEEHMEEEE
nggggagmflfiflggg
“Emwzmwmfigfiwflaaflrfigfgfiflfir
gafifimva%m§§£fl§EmflRflEE@
JWEEEEEWWMEME
gfigégficfigmfigfigfim
sflémfiapmwfiwwgswfigwwgfig
EEfimwfl
@EEngwEEBEgEEEE
mg Em EcfltEofi van 3%; E v: E Eat? EM
figééfifiwfigeimg
Hwfibfiggafiwfig
géfififiwgmfifigfifiégmfi E
,. EEEEB
.H.§%E%®%%EEKEE E
mfirggfifififiéfi
fgfigmcggwgmfisifi. E s
_5%WEEEE§&MEEMW¢
#:EEEfiEaEEfiErEBE
QOONEMNEEEE o
(s) altefrAPIZr ; atIv
V11X Slq.21 •31tIlb1IC 01 'WIC, 28 LYtc1.<1, 2009 7
3m4 4 f4fUu Trfdaal bT \v.! 17 r t Zr q
!rt. q 3112.T1 Atha th fi Vita. MT 117 tH 77.
'(641 1qflwqizx t m 3fit-dTh7 t, t+11
qr< triam 141 N31-qcr Trrrt, 3itt URI ttrI4(a t). 6CI
tit t I
(13) 314LTIT (12) fkr& Th51 uiI1f4WITirq 6 t
4-#1 klit I 39EAM c.t) 7 ctrufWit a-u
al-fray &raw
(w) k, q2,(14 , td4 444 ‘Lrqici-r 4)-
wzratuf ul,cr tthvUlt fa* Th-c
uquRi- (8) 31117 60qH an;
Tatlit tiq t 014 WI 1-11441“ 31-r-a-vr 4 f4f7ff-Z•an‘7
gpa fthqr warn I
io— faxqfdta Rco 3Titt-rt, cteific& aterr M-aw, TitTZTInt&i. 2ll
SP4-af mei mlar 0.ft 1-#1 f9w1-13a
vui
311.7111—TR
efic14 t IlAchat
11— lqfweix et sultwill tit —
gerottii sta7cit
um odd'
ft/dfatirell
snitot
3T7I I:0744 giO 14(
ftzl
qttrq Th-r *ma 12-0) (Dui afka 4 P,-IffIcr
(w) 42,5144, 31WeT 6 ;
(7)• fax4tuciq t .44141)e0 rr -42.41 lfh tisrilmq
' 3t!ral- Tim-maw I
(2) (,) lazqUatamq arrard uqtri-it 0) NO '4 Thitz- ft-41
ticoicutiief
Thi et. m ,341-014 ffi-4M-T
fann- 4-41 faft9- -et ; • .
CO • . 'enctd I.161 SrW Tiql" Q4 11f?
1-44. Wa Mita Thcl 7T7 1
(3) T117 *.71T+741 gpir 79' ce414;Ril 4 3,1 -‘4 Tra fazufavicia.za
TiTerr9. ill t'91't 1,iwar9. trr 14ach .4161141104 Zr FSTAThirica
1-wiravamq
312.171 um 17diff 6icf Zr 1.p.*:qtr 4 EFT *All 4 1IHif,cf 7 A
z9--4 taT 4 9- A
(4). (w) qR141.4 tru tri-Thate Gh w4 cue? *Pico Tred- s-r
1032 KPH Sa.Vidhaika_Data I

... . H 1. ”EB. ..
..EEEEEEEEEEEE E .3.
5555555555 .
fiwgwgwgawfigfifimfiggnfiflmfir
..EEg.EEE¥.E5.EEBE§E
...5555555555555555555555555555555 3
. EEEmeaEEEEE: .
.EgEEEEEpEEEE.§
.. . .55E555555555555.
..figggfiggfifigwé
Ewmc5jwvwm5CEEEE555EEg5 @
. EEEE ..
.555555555555555555555555555 .5
. . .....Efi555EEE E
55555555555555. 3-5
9555.553
..555555555555555555555EE55555 E
. .. . . . 55... 555555. E
. 5.55555 E
5,555.5
15555555 E.
. .. 555555545
...55 E
55555 E
_
. IfiEEfiEfiEE I:
. . .. . w EH 3 w n W_Bm_mwm_.
KWIESE.
55
555555555555555555555E55555§
55.555E§5§.5£EE55EEE£.$5
. . 55555555 .
55.5555555555555555555555 E
. . "5555555555; 555
.55555555555555555555555
.EEE5E55E5555555.E55 E
555555555
...5555555555553555555E55E5
5.5555555E555555555EE A3
_
BEEEmeS..EEmefiEEWMH
EEEEEEMEEEEEE.
55555E555§55§E5§E
555555555555555555555
n 255 $39 xx .32: 5:229 5.5x :59
8 thi WaTT 3M1E1RuT 11 /44 , 28 Wft, 2009
id trfiiir-4
viraryri N•1-• m-tar
(v3r) cq_11 •TertifcrIttif t rna-r-14-fftz itzrr kin crie T6 •ar%
1•Z-Ri4 \it-4 %au, t in 4 416ccquf tri<19 r+-ITT
*tf I1E157 -F1T-f4-1& ft-711 71-u ai1Zt I 4 crili
tiff aiThi IT iir WM irr4c1R •A 1 4.11 cdzn Trro \Jr.! ;AN 1-taA
Tizrrzfrvr er zrr . sr
(5) •(-I ci•-0 ThT Th-17-1Th-re tfrr 1-41 fäultir Thu 14-4-azrr—d-zr liRftzrIn
arEarte,4
(6) alfaff, 717-1 qftzNe7 MAW: 3TFA-7. 31-74 ft;TR
t:1'1f1
(7) $. 3TrafifTT 31-744 31"-TL'iT 4 3a 1 -741. 41Tf 7 SiAA gcr. ttily
a.f4-6r oct, 464 trf3ER tt-Lf 7t/1 M-4'4o• tn 9TrI4rt!tt2.
7f7fTT ‘Ilet tit ft emocr, ti
cr,1:1 wro 4,14 trRtr-6- w4 3fR 4-9 ari-Ek
ca:Tel TT Nit1c11f TriAw-Ti -ft-rot:Old tf Ai 3721-c1T ‘3*.7 1'41-ATT1 f1i 16m
ftdc; •4034- 3r24--r lAta.410-14 011 71 370 cla:f c.M iifth
ft41 <bid tr ft,- ,1 coo) tt crq rf-a-Err rcfltrR
Er2-.(iy "4-T 69E1TC Met -e,rm ft.41 37E2717 gi3-r Tff w 't all
ra177.iferuc;t4 gifti-c4fir a Wit ilt<T TRW-4i ft-qi 77-eux0 7-f qi-7-f:
cr)7Til 3r2.4-q-r fth--+4 S4flThTur c•t•4 zrr fth-4 ffi-gru zrr "OThAT137.:11
3-TO‘fr carr art6-r zn -q7:07 irtIt ttarl
3rQ0
foratliciLf:" TrWIWT ft --41 Vat; øi4 triRsstritt
cr).4 dig, tift •
ttit810,(ur — • tr q-Nr k, 6h)qk 77 Aiwa 77141741 S, 1956
A137-6 A ITRIARA '1ai4i at *t1ct) 3ITht 1-10-11 (AT Alra) 4
,1 174,
(71. (TR IrD) 4-0'mr 34)7 14E4, g-tt I
13— (1) f.tpiq1aEv11 tt ZT.cb.rd •14-t-rzr 61-t 3
A-1 3fMil
7 3qpr-11 7 31c5tT V, 37N71P.i1Rici7tafgri
3Ts
(cP)
fqflE4Ie14 7f Wffi1 2H fARRA crt1 zrivr q<ii afi
Tr4AituT 'N.5-11; •
(t) C41 .4 zn tv-TM
.Th7c 310*A
ct)'&11, -
( .1")• 61,11-11, RM1d 47e-
fr 11T f4- 31-7 W,FIT;
(-cm) faitte Muiilt• •lb-4f4snertl
urtitIchk 4 741 -47-F
triii9 cm9r;
(Irk° Th-T I3T ft-7 t11;
(A5:) Lfftf-AA:PA 7irr arwrte ar-IFF UN1PTh afftrun
vi••)riRcitri, 44,r) A2T1 WZTErrWIrk- cm•rr;
(end) -fcrRv.ricrEr 31-Rrtrft4'1, aTiZITTE UP-if aTR1cp4iR4t ThE
4).11 34h ‘31:t) Znk10L1f 72TT 3-9Thc1 Their -ZM1 Th1 inf
3tH Met 3R-Zi-lt Al ON (fa if[470-Af
LiciTql;
(31r6-) ITAai-77 Acal7e,Vit 7-CaTA t71-27I
Th-Tqf
(8)
, 1032 R1'1-1 S dhai ,a_ Data I
wese

21212 112121 31211211221 2m , 28 222221, 2009
‘ 1032 KPH Savidhaikq Dan: I
(E!) mefififfifimfififimsfimwm'm
m2fiefirf21mzfia‘fifing‘mgfimwm9ma:
WfiWW1—99Emnfimfiflfifi2‘1wmf
2mw9fifimfi‘momfiqmmmm0fiamamu'
211211292131211'231311
W1WWW221121U92121199229W2§2992113
31221122112‘1’99923311
e51? 251 221921, 2512} 11922 £121 121nm? a1 21 W 31219 <11 91? 212221
ET‘TH
521319192121$912fimww2m923mfi2m$ '3‘1211g221‘1’raa
Wfimwwdufiwfiwfimfiai9fimw199qfi
WWWWTEWEWHBM
mhmwfifiwldwmdmm‘wadmfisffifiwda‘iffik"
29222132125121W922921W2312m12212§99719¢1251w1
1912st5 11112219211 2112121 92292162222161 21513111192271 21512112
W321 @1211 mid (17131111124 «123129 ems 21139122112712 217211133:
$122.11 321 31121121 2131 ZhTé 2121 9211 3122111121? @121 221 "211 21 3'
92192112121 3121 2121921 9211 11212.11 25‘ 21121221 21 1—217?! 27462112171 :11
mfimfi’rqawffififigfimmmmmfimfiammmamm
mafia—cramméfi 312121 111erc2211€2gc2 (17 212292-21 27:12112391231
122219211221 217211612411 nmgafirfifi <12an 611192 217122111221me
mefisfim ' ,
mm— s21211212,_211fiz’12”m1211wfi2fimfih31992m1956
m-efiqfifififififififiémmwffiwfitmufi)mmé
(m29)2719a1,2?v§1(m29)2§1292212fi2113fi221fivfi,2fi%1 ‘
(1) WWWmfimeMWwW
fiméfiakfififigqtmfifimfimwfifimg
(21121) Wammfim 212n92127-2vn21192272r11
(2112) WW$W9WW$W212§12§9
1919131331211 22:11 21211 31:211231’1925 22121 22241,-
(21121) 9229211811$319fifi211 Wwwmmafl
mmmmfimfimmfimfi2mfafi‘1um9’t
afi2fi$fl2fiefia1fiamfifififi9fiafimfifi
M411,
(31rd) 215121211 6171 11512“ 3112191211 11211211211112.1312 21121 1121a 2122-11;
treiftrazT M-Y tia.bErit zif mjcr M Iksituf44t wth
crpfrir;
Ttieff9I. TiT4. Yelper In 614VIe111, tit14R1134
UPTT 191-4 M 3TRI fn 3:P419‘1 ThtEIPT mj ITV1P-T 3TTUf 31IP iftP1
t1T.
OTT% ftTUTh1 /4-1Ie11-I ti6;< M 31FMR muWATT trettl r
(t1k6) caPc11411e114 341211111M vtf, csTrirAlf '44 MIT 3171:1 MT1I.U1t-44
39;741 M 3171TUR IlikikUTTI warr arurratqh trn 3171111
ft-4e4Mcr MTF P-43 45 744;
(c'2) egeiLT M Rut Thik.ffit wtritti. cratqw uur 317z1
writr,b`lir m14-0(11141 MT TIV-41 31IP ThreftIRRctn.jj, 3TIR. 330
IT1tMR M aiftim-of Novi *it 4tu TriT&
(T.4)‹ ) itttra wog z.N .4 WIPTATT ct)
(ç— g) iq1ic4Itq M c0111 .4),(4 ferrcr 311UPLIO warri, th-114,r
utzu TraN3fr 3TRI TITtlt
(71-1-d-u)ftracfm retzr 3T1R ctrt-ff, 391I trfttathr *rt.
0,1111Nd. 3TIR fiTfff ct) TT;
fl 3Tfed.ZT11, 14RnITHI UP-TT 3TPITTtPTI reZqr4UW-111 Mil M-10
tre- w<reg. 3tr-6-ziwr trrotreric•ttr TFAITI Arl 71111 fattzti
aft R fAtiti3u 4,?•i1
,fl.ar ty(c.bH TV) if4.9.1 cin4 lac3., WRIM .faMPT, antri,
UR UT 3TRTPTT ThPc4 criVie114 M ThR wPvc .MTT ROW
.11RINLIT TE4749 M 31Tri 1 TfItTrif fthTTRI 1TP. "kt
31.-- ur *ft ath It-artr :out( \`Ntbii fisaftleiti ft:4R 44
tI61440 3FICH WM 04 mri .7rd -b-LT 3121-31. tiMTIP MI
TIVT fMtl 31R1 U1f4U t1T-41 tR tI9 3t4R
&Pi MI
..<1 \tt<ON Inkvf VT47 T%-t UT/1 311TIU TTECI.
rth-PIT 1TiPfl 1 .11T.M TITURT 1Irt alibfkall ZIT Tfrettrii airn
3Ittflt711 IT 3171Z1 33irk'm & aft3.11 .R-TR.M.R
11,4111 4,1 M. RTUTET MTIT4 211. ffiPUlat-IleRf ITT fareaVIWT UN!
taif-dcr fi911 Tip-TR 312TUT 1-4C0 9T61WaTFU 7r-e1 MRtit
(3T2Tar glow wr ftrater 41 -4 war tH01.1 gm \LINN! lir
fe.4 -1)i
,t)I tztPLic,, Rxcrfatarctra 39-cr9 anTim 3117 gal TRMIT?
1151111 t Mt/UM-fir-MI ft4t 31tUTITM MT T4Nt tCQ11.
311M1411 1.4- W11 tift 3tit m-7 war& t tir alarm-4:5. 4
tirtviti Irrer trr fatPT itET M P.411/1-1 ZIT TA AMR M 31RI
Pirf A .flqh, 'Tem tg ER g3I 3TE2TILIM
wr A tonw4 31-1-fiw arcr--4T 4IR-9 (EiriviTfOm-R) atiR uatwil
Gfrii iict 3t17 War ai 31111t MTTJUPIR 31-4.10 311e1
0-1111-1 aci4 Sztri 31M mt7 xtici) att ltfato ff.O• 3TPUTTU W.1
3TM tUlftP M FUT, LER ci44' m-3. twit :
cr-9 tqi *--antrRiii arof4 31UTTEEM 1. Pc4itart111
TIM Mtg teT1T TIT! Tiff ?ITU I
(134PH Sa.Vidhaika_Oatn I

n... .u .u-u. .avv‘l
ma 23mm 3?: mm 111 11mm 2:} $3)va a) nah
W;
WT, m, “333“ III was mfiamfi, ma—erm, maranfi
mmfiaémfimmwfifififimmmamrsfiv fires]
éwr.
fisafiamfimafi,wmuafiwmwiamfl$
W$Bfiamfiqfifiwfimwmfia§a§w
fimfiamwafiamm;
mam a} film. FWET. fizfim‘r’. W61. arm—4w am an: 1111‘.
WW1: emf—WT as! W 3ft? filifiw arm, a??? BTW
Wfimfimfigfimmmfimwfl'
mammaEWaw'afififimfiam;
Wam$wfimfia§fiwarqmwfiuflmiwfim
mmmafivmmfifimwm;
fiafiamuafisfivamm.ewfiufiammmafi
Wefivfirfim;
WNW, Wmmfisfla‘smw [asafilmau ‘mr
mwaasfivwrmfimfiwwfimar-uwfifimfim
fifiufiasfivfimfiaml
wmfiq‘émfifimmmmmflfimfihm
mmmmfim‘mafimfiwmwfim
wwfimfimfimfiwéfifiww
Wmmfimmwfifisafiumfifiqmfi
mmmmafimfivfimfiawmumvafiw
WWEWWWQWWLRIWWWWRm
mavnl
WWWWWWWRWWWWWWTE‘T
mmmmfiwmffimmqfiflmfimwx
Wmfiwmqfifmsfiafivmwma}
Wfifiifimfiéwfiwfiaafimmfiwfimam
fimmmmammrmfiyfimmmm
m(mmumfié¥fiaz mmwmmwuur
Wwfififififll
mum,fiaafiamafimmafiqmwzma§
Wfimfimmmfififialfi
affifiwfiqaswgffififimamwfififi€Wawuwm
mmmfiémfifimnFEWTmmsfiwwfiaw
mmfivfiu'mafififiamfimwmawumw
fiwfiwfifimfizfimmfiwwwmamafivvfimx
mmwmmfimmmafimfitfia‘gmfi
Wfifiafigfimaflfimwafiwfimfimfimmmm
mafiwfimfigfiwEFrmUfiWfiHmw—IWW
mfifiafifmwafimzfimfiamafifiwfiumu
m'crfis‘fimz’unfigiml
I
10
‘3 3RiTEITiur rFire.., 28 th-R441. 2009
(s) f474 time er Tte.479 312747 LF woltaree lIT *d
arum e-rijwi 4811azfree fret.=1 41ein4 miterre4
37R1 474 at 814 tvo \LNORwr 3717t4l1 flWArift/1p
01 7:IMT4 AR*ft1tzr Wf A andl MP. 317T64 V:174 fttiv
if414 gre Thlre 4,8 S 12111 elpicr 444 c0,111
War kW<S tecicg ewmi 4)-gl treirsf 177 fteR
old tre411q, 3fTWO zM ewe: 87-gera4 wer etrefluil afl1/84
Tite Ire wa 4 *4 m--Rfwef 4-61 crM1
item i171 Rickg Tinteb. ftR '171)
41 nIiteeft 1- a ao *IQ 3fi3 Mt MORA,
Thlltaret Zll tAttgi 7 TRA 1I5Ri4 g41J till I
aid 7rffer4 .4Rfli,4I 3Tittl. ffloqii 37t117
Yci 87f0m-r4)flM1tii ar4r 170m-41 aitrar
3Tf4Th a74-41 014 srfae. 1:d.4
v-wrii1Wa 77#111
14— (1) TNT 71 itcMffZird 114i4-1 elk 31?-47 :-
47f —7T trte 115i-4
(WO QiI1MR ftalteet
(1) ørd 1713q4*
gm) ccr aarwrl
871—t
(41, ) 1W1 fttrere ?as-aft-am-8 mei wer irel-th . ift re
vre47 814 JIt ItTllif ZIT fariT TIM &Me) 311-441
\H<I-i4 tit
wf — 114. aeft ;Of*
z znet gie tilf44 14(.4, iroft-tirei4
ft,wrfare;
(a) fograwou S we* Er-cm et.878 twit .7teet 1:61
3itR 'ETN fkue i;r)413z4 7127r•gi•1f eaPRE ftnwr.
tri4 tfli In 4 f-78 urre Thlte Tee;
(tut) tT aits faTt-r 444-r. ki 14,ur Liso 041 fafgtf.
vga;
(ro) wi tir tit:wrd 48ift-txrdel vaitf tef trfaflf4;
Tam ZIThVjOH AtiA In fth-in till fa-Ito all \Alt
— Dk&rlv-r
(711) 7ite elic1W1 cn-g 9Thif4D, ar4f3e0
7.,Te fl ffitto Thor vII6, tit 4.4{.-4)--t:e 74S
14;ii taut) Thireaweig lIT f --41 -ewii
71i;IPP-1 4.) er:- 4 81'781 wig; irgigivteRii ij
(..?!H! 711 !;13M131 tit 481. 4 2447.0 via)
I 4,
3 4tt:

. iv
u
'L,
_10
m 4 14—
’53 RE‘H ‘;vl.\“hl:} :I'ku ‘-.:‘. ,
"m m srmmw "HIE: 28 WENT 2009
flammma‘wfiaxwucmmfiammafig”
mm mom mf‘hanaua‘: mm: mm $Wmfilfi$ '”
mmmafififimmmwmmfifimm
ammmmammmfim.
mmmmmawawrmfimmw
amiqfiwa mafiafim, agaifiamaqammw
aweumfimawmmaml
Qmmuammmgmmmwmmm,
memamafimfiafififléfim .
mmnfifim‘rfimmg‘mamn
mammmmfimflmmmmfv
magaararmmmmmzm,mniagmfl ‘
m‘fififimvfihfil '
wfifimmfiwfifi,mfa2-
' awf—qas mm
fiafifiufimmai’ffll
mumzzfimw.
mam
‘ arf—a’tsnafiawmw ;
MWWfimafimfimmfia mam
$Wfifi$m1fiwmfimwmfiz WW'
mm,
w—mmmsm
mammammmfimwm
WWWW,WW%WW€M ‘
31TH,“ I
mmmwmm$mm$fiumfifi.'
amazwmfimflfifimfim 6% ma afi'cm'u;
awf— WWW
szaa m, mm 11 m mama 2‘:fo
wmwfififi‘lafim WfiWWWy
(mu m m": :n (Nahum In W “W” 1"“; I
~ 25*, m" n; 4 {’1 31am WEB; ’lb’WdU '— 1‘1“:
m: 0.1m n Bram i131 inn fi 24:1?
FL
vrm 4 wr4Tilli
‘ri (brio
31M Thl 3alt4T9
Pam- glitim
‘scir AWE 3Ffilt/NuT , 28-K67411, 2009 11
wf- qt-4 ufrttm`•
(qA) Ira* *tow ir ti1:CM 3-ff c,jq 11, yafavicri4 t 1401
zicrar trtterr :afw Trrtu ctp<4 ** traq. thrtfaiaraw
ft-tt 1-ticto \i‘u q• %ell Luo,q0q Fi 31a107 *T61 "01
- vrw %art Hu•ser cree4f4
(Tv% METTI" TIRn t trictit, "I'"9-0 44-1 ‘irwi; gifl'f4)4I" v40; ;
(oN0 ftwq AT* qjj 441-1.1, M-qwr 44-1 \i*I41 gki.14)4T 1/4114 I
(2) ‘34tiki 0) -4 qfofu stw, tlfq 1W-artr wf Trw5q1 ‘`)
tritti1 "Oh Wf erTil 3th \it'd' Wf 5 Trwit 0741ZI" "cr- Wf 61,111 1
iT4T Sr" rtic1i6tH f40/1 *I, ti "4"-fi 3SFATE4 -0.4n/1 t 3417 .<6a
wfter f;,--11i2stt ath c ç -
(T) fcifjiciq 0 afflict) tThill R.T4 tTS q 10—\11941 trg
Ti et cori ortrif 3th faxgraciici4 72-T 127T 1'40:f1 fk;
wtra tm;
(R3r) fcfcjq ml ono I-30d, i14t *al wq-et 14ffi11 WV.
f4wi itt titpqm wif4u 4),211;
(q)
•
etru 41.? ifith-di 4# ?Wm A.RT-4.1 .* 1 /4
ftliz Wzi VIR WaT tT; 3t17
(Er) tik 31-4:1T-daii m 1:11F9' cmr-4 viu t0-414 cor<ii ‘.ir
TIT qintuti 3121-41 TFIRtzlit 9N1.3114 unCi
(1) ,7111T 31f4bN 'w4tur gl-qr uTA
1=4-cm- yucl1 tath i;reif am" Rini 0 411-44) 3110171
4,6c04411 I
(2) ettm4R1, 014 011 0 4) wit TNT 31M"thiri crft "flt01.
arR TRH wwit 43ef reit.s4i t 01 31 01
TRuLaw A fkftra aTurefurIT m-r ftstir arftrirq gaimqr
_17- (1) qui 4137-4" faY4fac4icri4 0 T.94 Ivr f=400 61,11 r 3th -431
rtea-441 uzir aTantsrl* .uwwyl* aTE117 -gq -
gxcifcqcia• FW) vq4 iã ftepq ftrat aiWffifi yet ctR-4
arifitifq old ci-tu; r(94 fq ‘3cvN4Tth 614l ailrt
\itIct)i fkZITIT faflwirr .,b1111;
(&) ftruT ART-4.11 tuncr f4wil try, apWfu ft-mfZ41 "gI•RI
"i4W11d" rteTT311 A Anictrd. raga 111 't"1, 4)0 tIftiq 0
.Ritrft.
(it) 31R4 !I1hqI .myr wd-ar ETht 71 \I Tiftwii gkt
\itt trq arRARiu \in(
(2) ftfT 71444 Mir-irk2yd 4t4 6 , MTh. —
(7-0 optift, 3ft 3TaTET 6 I ,
Ttwrwure;
019) ffikrofdtmetu fWwilarzT;
(ti k) threourFq Arii1 anwd ftflurrivaai 7 In;
(4111) ATVI4 Ti7-ew4 q'i fkkm-5;
IC32 R.91! S..

”55E ”n $5»? 5c. ENE ”m fiwfiafik. Bum
E r 5255 E E0 6.5 PM % Ea
”SHEEN“ 65% ngflfifl
“ESE w FE any
“5% $36 cw Gamma
Igfifigmflfigwgng
_ _Egm§zggfifi
_.EEE%UEE%EEEEE0EE
. . ”sf;
aampfigauEmggefifinyfiEE
Em Egawwfi E «FE vb E E E g
. ”cpfiufififlagwfiggg
ycmahrrfiEESEEfiEfiEE
EEEVfiE EEEEwaaEERa
lymgéwgwgggg
WrwfiEEgfimfiEfiggfia
_E&Efis%agggzfisgagfimw
”Ewafifiwgwgwggfigwgwfi
.Egfimggfifigfigfiwmflafigg
ESE
Egaésfiégfisfiéwfipfig
EEEEMEEKEfiEWEEEE
_E%Ea§mfi§5§a§s§fi
fifiggggéggfififigfi
xzjfimgesgwma.
Ewéfifirgwgfigfig
Eggwfiggg
IEEEEEEEBEEEWEE
Fwfimmgfium
Elm Egg Egg fiEEfimwm.
ybglgfigfiwgggfigfigfia
E
._EEEE%EEEE%EEEE
amEfiEEaEwafiwEEEmiig
_EEEEEEEE%EE
TEEEEEEEfingQ
EwEEeEK E
cEEE Ewgggfifimgafig
Efipfimefiflfiafiwgfigwwfigwfiu
Macaufifisaunfi
EVE
FEE
Evy
: . . aoow #Ehm NE». FEE E E
3.
Huang
Egg,
SEEM
Egg ..,,
n.‘
,
ran, 7ffa
ref
chla
12 31-a7T 3ifiltirelf 41 Vie. 28 LUTEit, 2009
TTEV tt4f4 ct))4 c401•Ja) tii.11Z-ar Mil it
tin P4ita tt A aratrita 4 urrq, i 3TM111;
(ellcf) t11l4 TIT tiFTIci 1FIZTC.8e1tii
d)7T SITEnt ftFTThT. thitTI MtT
mist/IDOH t19-1 fa>91 Wq;
(yru) 311211W fa9vf We'd T171 it-81 911t1;
(91) f4c4Ivarc14 *SWITh1dnif8T; 3itR
(nr) ardir A cru0n-dqji .arfafr (M-ta tffi
zftm
u0011
(3) ir4W 1:4- TrnzA grit *4)
frP 4 Tillq I
18- (1) -1- ccr trfAla
(w)w, dtrf, ti artireT Prr;
(u) TtiT .4-Ncopt
awritg4i wFrrtrr tjI wat.b faArrr E51cr;
(A) "jv4 \,-Ncop .$ f4airn- 4 Sr;
(Er) tlfcr;
(3) OM Thtin;
M tritr-c gpa f'4-unfl crw (N1T
11 cold 43i:cc Itatn
trit3rq wr tiu‘Ler zit S f4T-41) Tt
-f2TFT
.1-181 0.11c1 111 \441 18TR9 91cif zzdM TR fit
-41 *14-(/. TIT ti13/2,911
4-'6640(10 Thri 17870TTfita mi tictg 1111 (1-A A-61fa-
crail 4 irtri
Ci't urea urfor 9 t; 3117
(u) 3TRiwrt, 3TRA Th-f ‘11
-4 3YiTI I
3t1ZTRT-(1) V.A113-(T.01) qf 3193-(7) A
co14 71-Cf7-1 f813 •111
1M
rth-t taw A w=1 Arr
Turgr Trz,14 vre -a zrf)19
W c 3TRIM-f4 Tht srfaftgrer
TiWar at13
sTwk ciThftr-PQ
aTftt-r€1 wa t ThT 11 3TRIWR 61911
Cacti #41t, tlits118
fWavr-ezi Riatrc 321T
ST411-ifl
iTR-4 fc1T6 XR wirg VI I trg
S tl sily 311 T11tr91 4 tin it
TEit &PTA tazi
43,1 3Tra 3119T84
f utwet siti fWit fa& color t, Writ
WUR 1WI vro
.41.1r iritif tpoift nr
Pgra wrIT
latic
an-Q-4R trit
14-m Trikit 4 011 3TMrfwif 241 Th
-ehal tl 31RIPTT119
in
Eirir 171
3T2Tar arffitftm f)4 4ti
wor frAlf ffrdr01 (Ira W1 SWIM
ram T{fAft WRT R1181133 0C1,
witqfni ER 44 itcro wer coel 311,
? trItEM4Tif3tr‹, facrt
Rif1erf-t f#4f3tal
Fe& crtir-4 sTtrA artrimfa
wRuil t 1Ttact( wriVa wtr-fr w
lwI
et 3117 ia 4-4 iztff4trq
gfAra Mei) arfrem
-EA -th TTrA irdur'&t
Thiz Di/r1
tirRrn, ItI&5T rafitmir aTP-A 191i
19— (1) MI4e4t7W1
A -OA ffft31iI
1TT-1) iiTh-TT1 A 31t2117171 1c8
1?11131 H 1-R) •NM3 f4/N
311q
AF8- fatITTI A tir-4-u fate,
•• srurray
-0,1 1
VcTh cP1 micrw ir1.4 51,11.
R31601
1032 RPH Sa.Vitihika_Data I

I I '
. .‘
I 12 4 . am new .W m, 28 mail 2009 -
(85:) memmmuemmmavfimfif ‘
, mamma'mfiaaamamzn .tv ,‘
(ma) mmmwfimfizfizfifi ward. mam aka-21W" .7;
W“: WWWQ; “t
(ma) W W. mam am :2: mm {m m 5 ‘ i}:
(#1) Pals—arm 3‘: W21,- em ' ‘3 v.1
1 . (a?!) mmfimmmmmamawummmih uvf‘z
- mm j‘ T
; . , (a) mmamquamqmmmmawmm 1" ‘5“
" = Exam 5. 15— (1) WWfiWfifiz— ' x ',
" (a?) agaqfim‘laxwam; ’m
I (E) WW$W5WW emsmmmflfim; "it
i (W) mm$fififiqmzfimm; !
I a»: -. ' - (a) W.- L ‘
l (a) firm W; I
(a) mummfiaifiaqmfiwwtwchmufiwmmw
memfimfimfiumfinfimmawu
mfifimmfimmmfififimmwgm‘
Wafimvfifiaflmmfi'fiwfiufiufifiwfi _
Wammfiajamm .- ; m“
(as) mammmmvmmm 1 "
i ; -= (2) W—(Qa‘vws—(andm-(mfi mammmma w:
I 1“": ' ‘ WWfiW-imafifizmmmmfiwm$figmfimflafim;
w$mmammzfiammxamwmummm-‘vi
Wfiwéfimmmaml . . I"
(3) fifimfi,mqfiuamfifiwfimfiwufii awfifimzfiumm 11:
mafiwvméfilmmfimfiamsfivmfifiafiwmfi
‘ v
|
!.. magmwmfifixfihuaéafingaamfiwmmfimlli‘,
:_;'i ‘ mmmmfifimmfi,fififiua§afiamwmmfiuaww*~\
",. . . afiafimafigfifiamfihafivwmfimfimmfiqfiww‘
‘i : ' W1 a‘rrhl »
vi (4) WvfififififiwfimQWGWWfiVWGhWanmmum-fiwfi. , m
1| I ' mfluafifiawwmammfimml ,_
(I ' . (5) mmmfimmmwfimammmmna ‘
wiwwdqfiw‘dflmfiéfifimqfiifiwfiafizufimumfimk.
Wafifirwfisfifimafiwfifiwmafiafimnfifi
. Wfimfifimfimmsfivufimmgfifih
- mwwamammmmfiamfigmp (I:
.‘ (1) WWfiWfimifififififiTWWWfil
‘ . (2) wfimfimfimfififlfiw ":1 6h} (Bf-Ea mm EN 311? i
gram fimm 1‘6 N may (3%: 52': m stun—Est am Tfix‘: and! . ‘
(3) “5175er an (rm me firm, Rim-J: um (fimu‘a arwfn W“!
F 1
m: RPH swedha'ikapam l
‘.3.tti TOW 3RTIZITVIT quid, 28 1001, 2009 13
Tr-cwil ti -raRr t) thur sifOrtii ath 41u4 WI
\ UM; I
tr-K1T TEtPRI VW Tilt-MIMI 6141f 4 WWII 1 a. E1mFfflPI
Vrab:SCII WIT -4 riT T thl--T Wrif ittat-A feic t14 C-Mul
ch 1111
tht '31EZIET ath —
-
(W) titiO fell-M. 71 aitzurff rittrrff 041 itha.9 iRir
timet ;
(711) tionzi .T1fçftrft1.4441., aitzutvl uP4T Thfitz47 44cti‘ trrwr
*.fg 3c1-1Xql 6 gri
thcizl aluncF fdiTrrr fl sr-4i thwriitziei thm,
f4-44ff 414Th44f ffm fikaRm im wkeft
(7). fagTITRZIE4 31trk f47-117 3112:11IN ffic, Mbiglal&T.
3-ffT4T41 61411 ath .z-fra aiTzr vre4?rzri nu 4N-fur 1.44 4
altirrla4 4 wcr-ifkm ft4 wr71
(8) fafk 1:1TTZT RtNI tpikr aitzrr-a-41 t. 31;130,
3TaR17 (4151 Tuftv witirr SP- 31tZrZri *4 0
3TRIM flew ,(114w eicki
20— (1) Yci ciiefil krT \Lich Tki Iraq -61/11
atir 3itzrrket .cr-of4m za 7111.1
" (2) OTT 34T141% Wat 37—'6fj fthi-avr crix vrWt th41
(3) law irfor-4.' a-item-04 vsa-Pz ‘91-41
faf
12*-091 waTr mci tfazil im utd oro? ara ftzjrth
41-1. 4 Sim .67 -41 30 ThraftaiRzi
14Cch RYURVAlci 4 W-41 way-ori w--4-4i sr--sT siO4.441
-1:1 4 ei '30Iftrit 4 th thTinfitz. m..3 tict̀)-411
(4) • TiT CTRT 3ITT4t ifl 3ecit-1-1 c,r) Wit 1301-0IT-efa 11.
i247-4 t Es-r3 4 faxcildvicia Ttthreiu it-41 ritur aci,)
&tea wif t wrz)-41, ath .ieviEr4•4,(41 1b) TR) WA 1142r
.<qc cm.). 4 tc441.0. 7Tif4T1 *In I
trteiliTfiA 21-•- (1) Thsa14ent-i4 trtell ,(ichr Tr34 "5-Ti 1.14 Jfl
aitzutth wzrifkM itth
(2) trtaT( 3441t, Tiittrzurdth ffiITI 1 wth Er&ii34 ThT Mnr-a
aqpftj arTNTT. thai t. 4.0ETur m1,11. 30
apzjw-Kil tri-F9 <041, aml-ct
trfter4 than 9-440 fkgavr 4),< zift. arranr ffi -
CI-11;
Th7cifkiiettf titeTT31i 14 1 MT. WRI—ti941 9-914a147:1
ath c0 Mtn- trittm Rite wiTt cb*-11;
(TT) zteil tra tuR fm itar ftwartsi
(E1) 34URT7 (11.4 gRri trklei0I 4 TO 4 .RItarr m-nr,
wcr ath fRtjijij i1 tei 7fturIA thtrun wR41I
0210H Sa.Vidhaika_Data I

111.1192 111111113 1512 1111111111 1121111 @ wagging 1111: 11:; 1321 1191119
119. mac 11211111 111:. 11111 191 11131111 Ram 1112 @111 mums
71111<b111111h11111>n11h1mg1mg1¢111fl1111112h1§12u211h
ImmawwzanNEMAmm-Me
1111113118 111 11111—111111 .& 11111111111 1;; 1121131111 @ magmg'
1111125.
511.1gmmgnm2maafiggew1nawgb
‘ 911119 WMBEMMJ—QJM
1111: 111112 1111211121; f5 11‘ W11 11111 1111111131: 21191111.
19mg 11111111111111; 111.11 L52 magmg 11111111111111'11111111 1121111
IMMWQWW
u11a1mmimewwmmm1m-111agaag
. Iwwawwwwmw
Jebhuwkmcammwméwwmeghw
wamumbwwmmmwwmm
mgnynmagyghuagmwmmgmfi
. 1u1$aanaggmgzgnw1nugmgug5m
wwmmmw1M$mmM1mmm
mumewmwmwewwaaw&w
InLP—Iwemwewawmwmnwmm
anamawwwmhimmmmaeww
MWEEM
u-Lawmuemaafiww-hfiw1szww
' ,Imwwnww
111111Lmas1mmg‘u1ggwmmamgfig
thmggwmw
xtmhwmmihmmmawnamm
-'N&Em-$wma$1mamwymm&$mmwg
Imwmm1mw-
UEPBEIEMMMBMMWWWWW
¢r1ammgng$mgmgmmmmmg
Iwwwwamwm
uemgflmraarzunungsehymmmmsewgmgmg
\ ' Imam-$1112
mmméflMQlMQW'MWWEM
11111111111111
11am1191111121111321111112191n211h11a121111u11g11111m1
—2111119u11g1a1za1e152;11211211112111mm11
- . W122
11111132111313.1‘1 mgpn¢w1mmfi1lwmaqa
111135-1922 11111111m1e1m1111212mm11m112m$1191121n
1.1mm
1-1-11111L11°11J2m1auu€mmm(auca1mbwm
{l 600E WSZ mummanm
[Ema—"NWWM'ES “MM "
1 —1LZ
‘ v
11‘
1
ri
Tlan
‘N.). Wa Wrq I
3121171-111 -4
fd‘aidenew aimitra .0121T ar-r 4,4u1Reft fksfau \T . colt siJ
.0"
31C1111TeL ff111%1 23- 1-476.WITall 31E211U4- URT1 3R4 milmft-LiI MI Mr? 3N 3-9-cbr)
ur met ft.Fq-q cr4 vrJ t4t 0,11 Mit
ffiu?dEflttTI
aTtacri-13: .
tiegscor
24- (1) Tf8 STRI 661 ei CI 1:R IL WtTil I
01 tift VartiffThd. Thnt 10: A-4t 'fii-flig di *1 4R41 T-d-1
ftitu1 viiq vr ct),)cii aerazi .04tieiT MT
Y)til OH 14414 ctr Tr4tft aT2Tar ErtTAt g ti, 44 %#t
e41(14 faISITIRMR M-4 641- 0-4ift 11T f4R-11
lI1'I th919‘‘i A •il,?‘,41)1 TIT .3i1I4 4141in icI'1t I
ffir if13Q.m. ff401 STR-1
e.11c10 TIT awirrum in. 3r- 1E1m mid if -
RT8744 ctr•). UWI 19l faa-T4 *T1T I
gi0 ZIP-1T 31:raPtifi. M ft-MK .1-49.11 411%.416.111. mi
m-444-c, T11eItT m 44m- 91tiI T fflA afr TUi‘m.)
em-i aft 1491:11 7241
3ft‘3tIck4 WM14 37-IM 161-F5a if aigrr-fFT m9t &
El
u24i
arat van fA-c, cvN,;141}31-n1ri:,
t41 fitM, itaRitRit TWIT arrLT ;RV:
11.1 M;(44R1 714 I
Mit ITRWM fi6iFagmefq MT, aiur - EF-0 ffi.I91T(1 LiffaM:l
.
c1) al TMIThIM m14da) 0,411-4-1,1L1 Likr
t aT9t -c-s.
31-- 0A1WE f4tai-o-r m-R-F)Tif 3 Mtartir met ftcht if3ldmf*
m'r -41t Ar-4=ft
W4 '47-f 061falrefamnt.a-,#1
ae
-111--d7 1-# thRR (61 -cm7, -041 tordm-t) c4')
-Wm
0E41 atroTtr- cfil-a
Trofticur-6-ca
T12,577MMI-
1032 RPH Sa.Vidhaika Data 1
14 dcH WT 31-11tifV91. fluId. 28 14TM€1, 2009
al. -€Rtfa 124.41-4TI M-7 ft041 I1T1-18)•
191tC0w ffiMct) irr S ait 34-21-ar uur-iified-tht iM Er&iftiy.
-01}.0 WWit m-RA 4-1-;mftrer flPIit 47140
eiqi wi thfkz-q-zr 4570- mrirf<i rrthfrim ifl j 74. !
•
8WI. 3TRI(49.1. M f4tft 31-421. -WI 31a 611cf gg 71),
tlteff TiThf vatiRwifid,ffi infM--iit fkr, 104-
941611 a 4 ‘34k4k1 (3) M 3414 T 111ki 31A-41 71-D0 MT nil
fa,441 RY414€11-6.1:1 Mt WM 111)614' t Wift 1:1&-TT4 ThAftsiTi
f4Ra4 0,11, flv-iTmet wtr if 10-1 Eitai-r4 fis# Eitur
a-Erzfrrr co,<•)- m-r -tft t
22- arqi 9-rItim-rft ffiY91411e19. 3TRI liliaMINI MT 4164, 'n.icit 1-WRIE ‘24.1 Witzt iItj

14 am 9723! WW 11313. 28 arm), 2009
(3) Wm ‘affiffi Eat?) rm— mm figaa an W77 @164) 21—5 #3251913}
fiWmemmmcu—W 2r?) tramway
Mafia mm) Efir mm m 1) We! 1111161)?) WW *1 $11)qu
(1211 BTI wffiffim uflfiafisflfix'l 9mm rm Wfilfii m
(4) fiafifimHEMWWfimmfiEMmfisfigm
Wren 11% 111, 2mm, fin?) (KW—Hm In W W 2r? 1%,
fimmfim(a)a§mfinwfirfifimfiwanqfiu
137m 3), Wm afi 'l-TI'C'IT Iré‘rafiafi 1% 1w Wamfi 25) mam
WWW) 22— (am if} 3R1 Ma) an TIE—La???) wfifinf aw Wm M
mafiamm‘:
aim—W
WEEWWWWafiWWWfi‘Ifi
J
mwfififigfifi 23— . {333W $ alummfi aw 3(er 331%an 'aé) figffi ST)? 37126)
mafimwfimmmmmwml '
(Hm—U: .
W
Imam afi 24— (1) 213 PM WWW In 51111 3%]
ngr
(2) WWmemafififiqfifimafimfismfirfi)
mafiafimwwfimfimmafiwmw'
WWWWfiHW‘mfififimzjffififi
WW 2F $2)sz afr 2131 W1) 111 mm ta
Wafimémfifimwfiwfimvfiht '
(3) W man—dz: 3 W, mi) wan-rm a‘a 1’1" fiem Em?) am
WW m Wow EB 3192mm 111W mill 91'-
mefifimafirfifiaflgfin -
(4) Wm gm uaIw'erfiIfizr‘: REM (w 1131mm Fm"
WW, HEIfiuW$mWTWVWWWIW
mwfimefivafifiumfiwwwmzfimrww
31W 3?)? WW strum? Bwfi ma) 1) MW 317m) 1154*) WI?
WWfiWm-‘HW aw fiWI$WWlm film
(5) EH)??? Imifiafivm m fiu’lé, WW am am W721i ““1“. -
mfiré 3711} HRS? uragaqflmfil
(QWW, WW2 WHEN sum gmwfiifimmffl?
$35 in W afifizfi I) Win-Wu U? W ah) I) swig
mefifimmwfimfifiwafifiqfimfiw
afifififivfifizfil
(7) 25rd fififi,sflWWfiWWflEn—dfl zfififiardfi
1'06? GM) fifififrs; 4%) mm, Q14) Wan?) W?) W firm
mfifia’tmanmu’ifiafin
1032 RPH SaVVidhnikq Dan: I
1/43TH STtZT 313111113u1 -11Z. 28 rh7qt, 2009 15
Th-r4 tTitiR 610 ?Mit t34 tale14 t144,901 wr Miftilf0WR
Ult 3c1t1RT (7) 347 014 ITRIR WA. f4bT TT 3171•FT1
3P-TIT Eivr 4),(4 If 34*1Thci
7-6Ti4g/Ici4 WC4TO 34 331 faiN itR ?NV c)4 W 81.8
42,WfOtrf id \nEfl WrCAlt 39'1T 41"
fur wr 347T tit WIT f4no Wr t
,siAtikt (2) \i-4- (8) If i2M-fit ITU M U4-4 t-R A, fWill Qmiw
viA w-T;) 3Ti14b-& ro • t
ciRt c4-4-T-d 3113- qhciLlia .34 Rthe.mtjcM4 48111
1141.5vIT M fOlqAct)N wl 4140 A TrW9T TIT \J•riel mR
3-1.:W
41 wifOr, PaR it(Em ZIT wr411r liIc1nui 1.( 114iVf
iDEfic13/4 f?4- ) tWA) aati StMEiti MT 1-14I-4 v11
Trr NA m84 f4gth 81Err, trit 312T4T Triv-4t tit)
1611qc14. If 124-4T 333M ThAt71- Wift 4,14 trrRiRTho
312T4T 434 4-161faVicia t +fief MT 'Mg 737 fac. 3ItTOT 37,1*
m:1?1M wrt Thr8-9 8R--) 8514 iitf8--r . 3z11--w-R• ctrMT
I
(1)
Thx4 it<ON T‘T rOfil ti4 gki rifiTT 40. That
961 Ettegf M, 17 3:1-M 3.17WFU \31-101 747, SILIThYllefT iiit
k3i4t4“ 41 t 3t) Traft-crat8 tar At 41 ttarr,
aparttlA ci,r4 tin8T--qi opt .wr ctic4 3TEM .t0
4161 welt{ 312MT f8ccr AtE81k-o- fb54t 31-1 %LI
311R174 If viit4 <WO MT 3*iMri tiTT I
4 •Outi tkchk 3CItTR1 (1) M 31047 Wray{ TIT ulltl 1-317 mi
MY-4T! MI V4 V31M1 114-11 1161f441d4 M VT4T 44
Trec1?f9 Tyr Thiwr cw ?rat EIR wiwt
wkir fkziwr 4),(4 4 3R-8:8A vt 98ifavicii4 t151 11w41 .134
ram IT v114 1-1414 VEFfteM tIchclf t AR. ;18-zErat
wet 38-q 319-ard 81in, 14)-ci fAteituf VT %Jilt!
ti 96ir1icitt Thnf ailti A cril itrO tirdwrr41 9 81 tiftercr
6 7 311:0-47 q,ir 3i13 i ctU cbrei wItrri
uw.TRT 0) M 3T0117 fitaiDT ZIT 7:11 SV W1;4 M reth NOTE -0-1r4C1
M4, %fact 34‘Wia 1908 W 3419 fW-311 wit ER
f.C4R EiTsk) vrEraT qiowl AA aft W Walti
z i4 IT icuayilt t w(cutt chig4i 8,1 TR? 4,4.1 fez)
4,,(4 craa9rif ftfSA RifmAn $1 Ain SRI( MI
3t1R UTPTT ZIT ntRif Tr.; 1414,41 31itrdT, 1973 Mell Q131
345 MIT 46 M 312n4fT1 RIWS -414100 tpisrf 3TIR
\i-ic) TIBET Tht‘ 4m-(181t 47617 8-Erg .Qc-ir wr)
10-193 3117t 228 312T -fr-fftd Ruitmi wziarct RpTA wzliti
71:1 tt.<01.1 9611-441e14 T17-7r-rd5 q3) iftheluf Z11 31i' 151
trftufT7 313r. M-3 3T-M1 3113 fth-itm1 wrifwg) W
If f=4-kw t 7TW-41 aiR 31114167
I
sraTtrIf icciIM
fc am-gm
Mem v4 ufl
1032 RPH Sa.Vidhaika_Data 1

lugs; A
mnilmamnwayaggmwwwgmy' ' '_ x
my} 1;; {gimme gem. gm {Lugzue Wit & ugh: numb ,
ma 2-;er U2 11113th gm Lea. gamers W W tum (v) ‘
IW aim gimme 93311: a .p- me 3; 822 we ESL—1MB .
@ngaanznurmi 1511291.- uzggegmmmm
zwtmmmawwmgsvmsvc ‘
mageczetmgamwmgnwmmmahm m‘
{EJWQLBEEMWW$MEM
wgwafifiwgmmeLmeewamwgz
kfipwgwfiwwnmmmmmflfig . k'?
wamwhmwoetmwmwwwwmmm
IwmaefiisgPQ$w>$mmmwhuawae(t)mnm ‘(e)
Imwthmee'w ’,y
Imuhawhwmwwawwnawm < 3
$EmmMWMW'WWJQMtEmEQ . A
wwwamewmgmmmw J4
MWkaes—AWJLWMW 1
fiwwwmwnmmmwm
utawawmn$nmaemmwahuekflémw
agraamnmmnwwgmmummgn (z)
. Immmgwmgm . _ i
$MHMWQQQMRW$W
'mwfiuuemwmmmwwamw
me'm:wwm‘gamgau
Mxmegzemggméggmgémgmm (L) “9:. mugbmnukg
’%
mwmwquwzwwwmmm
WMMQMMLgmuwMWMME
whwwwgmwmwmwbw
memummeww$musm *' -
mémwflm$wwM<wAW ware;
Igwhmmmmmmummuw) 1213121;ng —sz gmzangP—Mh“
‘ Inggli '
&Q&MMW@W@W$W 3
iflfléhéfimMRbQEM-W EBB—41h. W '_"° < A g
@é.mwtikfl%1§fi@flfl mm 22 ‘ I
wwww‘ucbfietazemawm(a)mmm (a) '
Immwwmmmm ‘ - , J
mwem¢meaflaxfixwmfie ’
alegwmmmwaW$mw _gzx\.;:»—
’Lamwymflummwmmmwm ' J M
luflhflwamwwszmwwwomm ' ff'j“
mmgmAWganmmgmhMmepam
s1 sooz gm 8: um». mm»: mm m
16 3411tITTRT 4 11/4rfC, 28 Lbraft, 2009
#17-TRT (4) c 3Tt7 LIRT t
tlt-4-1f -0 4 cr,,,ettlit vii•ict7R1 trrc ar'17
cm (71313R col R1-74 tNct)k M iThm-tur \<1-1
crgilgiet RiTW A '<No, tkc4,17 gkr 41 IT Zffl wotr. 44
W7k-ftff crrfli
dc4lcf, cgeiqf u)tir fi15 Iu4 *1,Ictthr RITT
fkNff cO, \3i-r sroRr 31- 1 9)149,1# LIRLITia741
4)1 9161 Thci v114 TEA 01401g1 Met ft ft
La -RflT *Nct/K MGI Rite #g ft-reso-c-rdiT 3Trfa41 -th n'T
Plhciwrzr 44cger 7-61: mbr -1 war eNcr,N
ft—it co.< r ERftitfkv--rOwraw warm-rer crwlw
4NI-0 t Mvr kw-t-et t kffr TB #i='4# TITUS) 30
wqrtr *vrItt-11- QI WU- A mar sir) I
(5)
,<Ial 'MOW! 661 elIc,10 Ll197 34#41 SITTP=1 t fd-trup-r
zrrik *A-11--47 A 4)) 3g-v01 Ai-Rr 3-4-T51
27— ItRt 661faCTIc14 LIT-41#T RTIT-frcl# cIU alf4R1 3#-R3.1cbI ch
AFTT4 iii 31- 1 3TUTILF Trr 31-R7 m-4-4(ft Trgrfa-aido g'avr VI lIT
cr-a-zr M trz--4r-a, M 311-1 mbrRI fo,41- zor
3T21TIT -0:1-4 30 A- i)PziO. A Pwift IffrTr r&-t
3TCRTRY \+04 k cr/) 3i7TTR, 517, Lbr)ti Zfl it-R# Vt7R ml
T411 -1'14 W). TT TRR1 \ ,̀114 # c+ ii 7 1171 afr ;r-
zn LITWI c4,4 anr
4g:
,Aaqr 74
r9-
crrok tr7 Ilcrr
3-Tafg;—•(-IId
qRf q'{ '14 &aft(
trftrd719 cl V9-14 28— (1) Ycl S41 ;raw LiRfltrA ,41,3-4 0cok gN1 34-10-7711 gi r
wtM- -q-Ar4
tid *EFT n-1'1 t1 7# TT 3iTtRa# PLpi 61-11 flch`t
lii 3LITIRT (1) A ?az Er W-1 -4 izhm- ziR
:
tritg wei fst vr10-at
IT13-2110-, i1iu1 TT +16-f ch) TTITEfid#m Cliell (4-2 7fReATT TN
Oct) ii A7fT1I), 3dtr 'R;IR#T6 (1,15 ZIT wflfl9T f0TT9 fbt
Thtfit UN CI CP CiftWitC iM i iiRci I-PO(1'4 117an fl
RRT
.tnLf 3TRITT-0# ctr0ml T -
R21r
er aifltai fTZ1I 0 44 0isii;
Th-vR fth-trr Trzrr ?r
104-51 9-Em-rwa A t W1 old trs[ 711
TRM-R,
3462:1719-. sTu0R irr 313TIVF1 2c1 A Ths-q -CreiLI ar ;14'f
arpiliT
fai# tn-cr ta Itch-rf31zn 777T- IT #14111 T#IMI
3TITYRq 371# giq fdt 717) fre4-siazi&r -12-710(ta m-,zA
-f-'6-4 4,14 0-trq re4e&azrf * t) i aiiNWu
1032 RPH SaNiclhaika_Dala 1

H gm, ,1
{ € 16 w W W W, 28 W, 2009
{
(5) vammhfimfir ma? asié’wnfi fans] .2
Wfiafifiafiuffifimflfifisfivgm'fi
quafimWNrfiqfiafiwsfiwwzflWm ‘ ‘
WI?! FE W Tim, WI? gm Eh an?! 211??) Ham as}
W'WI
(6) Wfi,afiqfiifiwzfiwfimfiw%wmm
Wafi,wmfiwmfiufiwmafim
szfiwfimfizfirfimfiafififiwafimm
Y 1 (7) mmwmmggammamfimm
‘ WWfiWfifiafiafi§fimW®
WWWWWZBVWWWE,
“ wwwmamgwwmmm
'gi WzfiMfivfia‘mfiwgfil
{j (1.; (a) Wmmmifiwafiaawmfifififim 1:
.‘5; mmzfimfimfis‘fifimfifiifiwmwfirfix
'i‘ , Wfimw 27— Mum—amnesmaa ammmfiammm
:IJ ; fig“? meawmmwfimfifiwrfimmfiméém
. W W$mgfiflfimafia§§néfifiwia¥wfifinfiuafl
if" awawfisfivfiffifiafififiuffiaflwma§fiamwam
‘ j mamfi,afis‘3mcmm,qfifimfinfiummmafis‘m-u
;‘; quinédsfi'l‘n'g’rmdagwfifiwlrfiummafi’ifiafi .-
' DTQT‘T'TWWI
Mix -j
j. swam—m ,
j WWW 28~ (1) WfiWWWWmWImI
i WW WW1
:' (2) WWW—wwmmmfifiqfifiwww‘m
3": mwm(1)fifififsaqfimthfimmmaé€mfim
W: '
mwfi3$fifqfifififilfifimfififlfim®wflfi
qfiafaflrffififl’fmmafimffifimfiwafiéqfifiwfi
www.mmmfifilfimWWHM
mefifiwfiwfiafimfiaufiafi-‘myfim
W ‘ ma-Wfiafimmmgfiiwwmwv1éfiul _
wasmwmaflamfifififimwmufimm ”
Wamws‘rl
'1‘ (3) wmmfiawmm$aagmmwm¢
I; NW,WWWU§%€fifiWfiflTafl§TIW3W
‘ 2i? fiflfi flan—d m W21 In 11m 211 {trim film ma $.31
‘ V W mwmfimfifinfimfififis-«Ju’afimfii‘afimfifl; :p
i mmumaawmammmmmfim
1032 RPH Sa,Vidhaika_Dala l
14 NH cfrii.) in 31:RTRT (i) ZIT 'OVUM (2) *I faz 4131-4374
. • 3-ivrifuff cm-) VI R.O-RT cm.) A Aar Th-R Titri) RA
4 f
q4 urf4trz $11 300•31-1 3TTIT-6-q Th-T71 faw& th 7F-R4
'WON' cI 3fr .41-31ka4 ii3rM1 ITT wzrzTriT VI
311t1T-C (2) 4 Mit tlifikwi ThT ThAT9' fkvu9 Th-V
(4) nr "crwro) W 31tlh g 4RM-err 4
wc-rET tri-clig f0-34) 4duer W faq 377-4T fthm 3:r0L4
rta-tur 1),--&?scr M fk.; uzr-474 1-0t; 00,1i
(m) RzuRcarmer it aTRTAftel A ftlfr. /if*trzai at 0
f/ufaerrocr aawritErl, vur aTR:r 04urRzil
1=1/ 4P417 in RTh 14f4 iw io 3T2TOT (114r -/hm-•-fr
(Tr) •(-1 4-91,11.2t ‘iL111q)im srm4 14,ur
(Er) kit4ifQut 3.1-t am teeter A ctigtf #11.
(3) M fo4W 3Th.. 45ifavaieN1 z15't fq1aciici Ti
-1411:401( 1T-C17 F511r uII¼ 31Y
Riiict aTti'MiFsII .Qtrr fUtratw 04tr fur n
t'zcatrivicr-gru sr<r-r iM 01,) criel) ‘3411- r 317-{1
strum RI/Ocul3Th ffi 3T-i-dr4 athz3) smr4
cm. Trr PTtT 0.<4 it 3rn 11T11 wrvrit,
(u) 1'0-u-ft-ark 3TuR:17 t q un it ffi4 trta4
fqitlIjt I 3TR:f *IS Fe/Titer
014 wA
toorqferl, zarm-Tref,• fcucRidt tr-4-4 ii
1-111k1)14c14 IRri ink iM
(T) 4terra4 ml trur aT74u -Et WIT Pcnizri tr114341
417 39-41-RT1 tr-c met vr Th-gWr met tit
aft m-dair t.
(A fqicieiu S 3arThritt (tclirti Th-1 ci"()
0r4uirquI 6t,) A -sTF4fr \i-14 Terdfter *13
acir S f4-4-7.T9 xr.1,
(z) aiRT 31.41 fa tift aared-zr4 ucr ErF4ffier4
utrard fa,a vir-) w 14,4 71Tr-Mit I
29— (1) Tfl 3t7tWmtr it -34-0791 31tn9 •<6.1
aitzrthil im 014 trnwq colii4 7717T -1 -€11 ni-flafto
tiincf ZIT ‘3.-14 rth—kft feIRT WinT 1-4)4 7T tru';'71.
apt :—
Imo urth- mlIA 3117 'b-ti ki-Rbf
-111110
f1hflclQ cr 3,r41 111\-11.r1311 t IFiruitINI it
fè Zafa i),c) iik cija 31t21119 14 q omit
ari-ayr Trterr tTñ41144 •
\IZri .-.13Q9raft 1Aitcri-tr1 3117 *Warm
1032 RPM Sa.Vidhaika_Dato 1
(T)

2mm M w MM mmwna _"7'(n)-
_ 'mmwmghhuemzfléle (1;)
'mmwwmww
iaQEWWWW'MMuflwW (El).
mu:
Mhhfiflwwlfikflflbw (m)
. A —:2;reke
'{zwmwmwgmwawmw
asyiamiswmmewmwmww
'h‘éwwaamazewwwwmfi
' Awaiammewwmum'
QWMWRELEWWM (2)
wmwwwwwwwmw
bw<Mk$gh®1flEW$W (rs)
_ 2&me
gewmmwwwwgwfinw
waeh‘mmawwwwmwen (ti)
‘wwmwww
tree #33 W913 W mam—m (a)
'wmmLP—wae
kwwmwwmmwwm‘w
yumww$mmmgnww (a)
'wuemwmgmsewwmw—
wflwwwmwmm
mmwwwwmmE-Wg (a)
‘wmwmwwmwmm
waewmwwwwwwm
wéwmwwwmmgme (a)
'mamamgmwwm (n)
mmmwwm (LL)
@ummmmmmfiuwwmmmuagw
aunmewm memunwmsawwmi (a)
mawmmwhww¢w (ya)
Imwmwsawwgmmw
wmmmwgw-Mmamm—w
KL haw hi km awe $ M$ W As
Immuemtammummmwnawwwm
m(t)mmmu..gtmmggngegwmghum
mwazwmxwzwhfimmzmmwmwm
almwmwmwwmmmwwmwz
ngnmwwmmmmmmw
m,/A
4 <
CL •
! eci
(
: 4,rt:
ntro •51<`11E4RW 71-We-, 28 th—COT, 2009
ffiftittft wan- m-T4r, 3t1T -9-9Thcr 3re-m-a- ffitrfft aftv van- Wa 3117 ART Th-T4 TiTnj rr--4 mr4 click 4-ma4,
M Thy-ea-arm-a 3TEZR1-q CNTIM-91
IT4tei-rart 44-r anT ftreatTr-ma 4-4ftmi, ft-i*rr34 at1T crifrar trwl * fit 4404 mcimk ar-4r
arfroTTif. arnrMart ftarafMar, tral ar'N
40014-0mt 4--c-r4 m-R4
(w) trfra-434 ft-ir*. 4-4c Th-*1-0 4-mal4. 3ft? fkgWr 4-ft at1T Elk-TO aft ar-T414-0
*wftzlit,
foafhirma arA fkar-fr 0 4-J,
(w) Ree-Fr urwrar1 Thar-fr, 3r-i-r44-ffq afri artarcr4 fk4 a-mat mr4 ar--4r fola vsaicr4, aft 3t1T 44* fta fq-41-Thar 41-4v fk*r arzaa-9- trro:-4-ffi-M mTffr,
ttr 0f-vifizt ft4* fta tOffai,r utr
-er War Trar . f49- m-4-arl3t4 n-f44 3it? trItaW-at. artzra4 31zZ1V9" N1-4, 34---t-srfT14-a arEzra-4, fkfOrfk- soatirr-s-rar1 3f1T 31- 1 414roal wrcr-m, (a) ar- fa fa-g4 r4-04 art? Tipt Trfkfta. m-?0- arRT ffinfterwitgrfrwTrrit Tr-eza-Tr atk Tr-614am f4-Rt ttr ar-R:r fk-*Ta WraRturaa Iraq
Titrri fty arraza* 4401
TET-44r afri
(u) 4-1449-0. &TA-T*1, 3i1T TriTterWM Tr-drr wr4 ara 40,544-*,
(14) 31EPTTO atly 3.1- 1 slew mlwrfr- Tlirr 0f1 arRT ath w TrIr42m1 g-r-qT t ftz1- TR 1 •
3TE/j1T4-31TU •
aritt. aiti -thgrr
1*ra/raw m-r uffi-d--4-ff, wr-41 Trftrra t.f4-41 arsim
30-
kaR War warrr ftRcr-* ar- r WR4 t war, foafThar-ea gm 44* wqtval lif4 ibir fka Tit zara .
nr crwrT karT .'war 4-ar arfif-* ladaq t-aRma 0 01 ft4r-*0 4-Tr*te wiTlif War warrr frflzrr 1 /4 1 (3) utrtuRT (1) arzik AZIR Tra ;r1W-1-4-9- mrt kr-4 sedft-
14 TfTwrv aRgff warfl
r-r*-isrr titan
1032 RPH Sa.Vidhaika_Data 1
(1) Fdr-q-ftr-ezf * a 4-4 MIT 4w q,'4 4134-a Nvfi
31-
am:ThiW aarT fka w-44 atIT fk-Or*, 444p4 f*, *at

l meg“m'_wqpy/\'FS Hem ZEOI
yaaw$2hthEbhafiwaemym$maamg (t) —w mnmmme
s -cvz ;raw amrawur , 28 th94t, 2009 19
co Irate Zff ti% a4f çf ZIT Oawif gkr, ,ek47W:Ve
fkikm vart:u ;ff4- azi m-23. 34 m-a aft3.st-ce
awl 3:1 araRrwr w9-41 atar atm mei wNli
(2) rnI atgr at gcl-P-1,1 k'W 'MTh. We tR v)t.g tfteir
efiat Trite • \LPtcok A chid tifer4 tkruk e4R 4,14
*33r34. autw azf 30 %Olt IMF A Allift I
.(3) qI1cna2303T1 w <Ivc‘11.<01•I rgwr 1"4“). mTiteruT 014 Rc
Miff 4 a-ra ssti4i1 aft3. 33;1&94 az• 4,14 trt3aa it4R
Th.")-4 v4ItObk Thr ftt wz14
32— (1) W111 eve IttcrIPt qxciRviegf *WI'ET9' ZIT Tra:
6114, Sufi!. St11441vIM TRW crq ftI1ct AM EX tri
oni \JINEItt *IQ 144.1ct), RIT4t4 mffi"
<AT, ki(In TraT zrr 3arTiRi aarm-rer .
faxafdvidir fa*tr atsa altar td,t) 7r4 iiPj .33-ttifr
fr ar 1St Rmlemi t)" %TH.) tri ev1.1 tket)Pt
faxcnviclif We 3TRTM141 12 71A \Alf ZIT OCIrtirt
Litho (i) 4 Mr& 61R. Sc44 ZIT S.V.141)v1-1 Eaff t
tiIP qflcj 3I-1 Zfg *Me ‘0411fiqg glue gp<
fkftW *FBI 3TIA Tff TR! A P:ItZ I
a 7T7:1 Ittcor te efffii eafAt 7T1 \kr<coR URI
3FIETTRar &RPM TTeTt crre4 .*12.6t .iccrtcHil o8e4T. 71V
3TRIITR Gian4 WM..zrr. ar-r In- 34 ,Atil
*Nchli gwr Thaflicr mc1 7ra, 'net fdnir sittaiirr
mftmrnui* 3i
i.
firttbil
a ffZ
Wr1 ttra
193i RpH Sa.Vidhaika_Data I
alumr-91
irectuf
33— 0) re 3TRAEPT ti Li 7 arTh-afaa a3zr agaftra
RicwL uipict arft)-m-rft 3413 %al-acacia * terw-fuff
1-1<ta, zrerwma, fiafaa
•
in uti44,
(2) we TIT arferlktra ZIT tantifif tichilmq 71 el' 'rtocn 312/4T
31-1 ar-13u3 f4rat ThsOrr *I'v 0)4 \imagtf cdnir
zrar atri 'Attica atW 3fq1 34-04 3FalTftd cot -1
Alfa trftqt fad vr71
31101.M It4Thwel ; 34— 0) fdzafacimEr %RitlinO*1-4ta i*PH4 tfk gtq1 t 17t
eqefi A %A aimft9-* ?e'er *1 14 q11Zr met
ft.r tit 34 f3R-tet Ridcr fa ar(41 n TrErr
t,a ftravr *1 M4),(4 araT “414cr suRrm-rt -Err 144,1a
tiqta tar 3fR We area 31a1tr * f=-43 ftt -
7rf4Tr f2--frwr Pa@ mur t tictu V9T c1L
(2) m-4-4 &nu, q4- fRft 3r-4r Thcnitr 34faARr -1;
faxardema WIM-Ct egie .4U awl
Eno5Tt 3IP1dT Wt. snitwrft 4•&EA
zza zrz it ag 434 Thom mr gregfer var .3g
S1

a . aamaamamraaaiswafi, 2009 19
1M
i Wmmfiawfiamwfiafim,fiiémawnsa
g , www.maaéfiwamwmafim
5’ _ _ mamamwmmwmaml .
giftef‘ . (2) afiasamsfiaaaaaaafiwafaaafiamafima‘w
5' ' WWWWafimafiaafiafimfiafiafis‘
fi,a§wmaésofiama§1aafiaafimfi7fil ‘ '
‘(3) mmemmmwwmmum—a
amfiafiafiasfifiaamfifimqfiaafifilaw
. , Ufiafiéa‘tmawaaafiafirhafim V
'mm 32— (1) mafimmfifiwfiamaflaammafi-
m,§afum§aaam$mfiaaéfimmama‘rm
,- amafiaaaammMWMEM
- ‘ mammmmmwmem.
(ammafimfiqk‘ma‘rafifimm
W‘$wafiafiafi,fiafiafimmafimfi
' mammaofififi‘fiafijgafamgamagmaw
, . ‘. ammmaaaaammafifi%aaaaaawam
" , ' . wfifififiwwfifimafiafiimafiwfil
(3) afimmfimfifiv'Mafime
mmfimmammmm
i mmamamfimmmmamm
'1 .' .mmfiafiraafimgaaafimml ' ‘,
a
mum-a?
wmmmamafi 33—- (1) saafafiuwaafifiafiammmaawamaqafiaaa'
= .fimmfi’ififi ' W.W$W‘WW$,W
‘1‘ Wflm, _ ~$aawaamu1afiafaaafl=ifliaagamfifi -
-(2)' 'mmmmWfiWam-me
,f ' ~ - . _mm$mmfigfiafifiafiémm
wfiawmmmmmmfiamfi
. H fiflfiafiafiha‘tfifiaafiml _
mmw,,u— (1)' mamMmmm—zmamwaaw
.333 -'Wafimmfifiaafiqfifmmaafimfi7fi
mmanmmflmafifimamm
amfifiaafiqfim'mmfiafiammm
'mwmmwmmammmm
‘. aamfiammmaafiaréaawaarm.
' "V(2)fi§mfiamMWfim$afififafiwfi
H ' 'fiwfimammmwfi,afifim
Wmfimaflaaaafiamfima
i. aafiaammaaifiiaafiafimmmafitawaal
1,032 RPH Salvadrnikapam l
20 . \i-ck RkVT 3MIEITPT I1/44Z, 28 T3N'9f1, 2009
artitur
th-4 ct“; 4 trt
f3Y<I14.4Id+-1 es-4114'0cm zri 3T2rOT 11'11-t mr%
<pi cg ci)crcr Tfr MT‘Tui 3TRITER4 fTrr — •
() -30i cOW Rfr*i 3::7-tti I vItIch Twill4
1t 4, -a%
(RT) cr84crit % ite %A arRTT % %Fr -1 -zr.r t, .11
,8( ci-, 4 r:
8cpgrz -it en, zu
(Tr) u-%* ,t14*L1 * *ILI 4 m-rzfi m-7-4 cua f4:A- er frqt--4-4i
-4m7ffitsi% zrr fte'oTr % colli Vt e, zrr
••
(zr) mimet coMcilt % 4;14 itt atikErfktf 2fr Rma-44 Arri- : 1
irririf7T 9N- ct)) SPIT9 -9. 9501 tr I
. i I/
chi trI3T8-, wIltzo- aftz %a a4 =go? %-g--fitt •e• -%-
forrt -8u % r---iisi.;:i ' ,
al-114VE tl- ta19-ftleiLl t it-tf Triftt-Tt TIT aTm
F4-t-mr m'sr •rigrni 31:!.1
nr 3TITTR 1:1N. it fir er tzt &mu Th-% Rr,,g glq prT t z%
„ I
LiPtm mcr •ii-r 4 Afa•-- 3TZTWell -IE.44) 3TtENTET e 342T9T -7-1-
311TI-R TIN it: ti
9t cheict0rict) 31rnN"9 wr ttfr t arzmr -RIA tfir. tit t c"
g 1/4,1) factf-asuc-r% * ogto * •Iir
8c1
- r at IN fs# er t frrearrFzug7r v g ccr 'zrr ITT mnr 710
Cr> ni, 1:11 1411 lUi
;
37- La cr, 'elrmm ‘3a fm1 (4)1
er -RzuReriem*fwzir wri%8•Ttler
31RT f%m-T% ti tikich.<-01-1 34 Pond VT
F4z141 •4-K *0 TIT ‘itichf
6 tf 6 ct) 4 k t ZIT -1 a am--0-r f0-0-
Ivicii4 t Wr mr14--t-lt Z.
Sit m-r cpld -101z-04 (-€* 3:1-
914a mRfktrq m't f0tPARRif..
Trqrfkm ct;h mm .1-fr t) *,,,r artrtzrg 1% \l‘8,
8 srtim N-10 Millil ,
311-€11 t TIT -16) Ul ‘3cra Rtm t&rThirth cb) 1%
-fltz -F .-Err %TOR atlti
cgclifk-Or MI \3 tf trzfezrzr aTe- T tiTT • •8••,
T-TN-. w%*81-ziF cpli fra-tir -
-,,
-I
(T) ,er urtru % vifif It mm icrt-
a pi .1iivri ,ni ticocir 2Tr.
flit! tr aTf0-- * i-rmcr, zrr •••,,
- (R3r) RYcnE.Alcia * ltit ;iff0---
rtr zrr arru-t-rtr 3T2T6T a afttl
A P-i WI. arrOM kr 41 i''-zrr w%Trri
387 NWT *I .1 zIT RzcAwqm TIT
3-Tit itti 34ThtTt, Mlic.bl't lir -34. ...
f4m-Rr * -1t-€S Sr zrr cIsETIF 9
-9T??C 94. LiRILIfilt M arfit
A ftt i-r- r 342T6T f.--% uri4 *f'67 -r- 1:75-
1 Irr amthu 1W1 4'10f
010 ;RRIT f -tir r.31-m'm .
317 9 cr-,1 3T- T1'0-14- m-(4,00- '
,
39- (1) facriaS11c04 t -Th-0 A fl
g flVlcl SW4r vil- cr,1 *Hi
a * WI 7th, 31T8-89, Tp--%, 3TT-0T, 0-040rgl, TITh#1:ATI'
3T:r 4t0I‘.4 3T2T4T face-PaeTrazi gi% %mcb
‘ \fro-r
i''--41 ,d ,(-c.• mbr fse vitt met 14Rr, AIR
w8Tftrm t e te Tilitq.. 31*-47, 31W-HT, 37-
a7f, M-Ptargr, IL
tictic-0 3m--0-r 4't-c1Iut t &NM ,, ‘fitt{ A ve0ft
itar :irranir -- t)Lr A -txt-crr mnr &Fir aft
i-4
it(u tP-TT ctici6I•1 t PM %Tar * 'trig A
mtr SA co Vet, 1
- -1-4/3t ‘311 1=& 411.0 ilsi mfEr ;177 .,
-61 ir41 tr-idt 8- 4--t 7110.11 1
-9-74 trdt, -11.,1if
. (2) 'wt .5 ft-41 al-R--1-
1i -ar
i' --fri.i.4010en---d-z4 i;cp ITU "9 e", favq140c-14 m
-T 0-,1 7,4
_..,- I•piE
.< \•-d• in- 31- 4 311;93f itN'Itcl 31-9-4- VI
3TITTINT (i) cr .
..: . V iPid 9-1% u-m -R:w Mr -
r•Tr-5er• tr, cr-in _0 -4:',
, •Ii:
,
.•
--fpl- S fatm uP-Tr &1-4-8-
R e it4 <r) ,) * fA•?....
* ‘Lem A -1713-2,1% 814 m`r -ffq" cicb 3T4err % m't
-rtrifr, 0„- t'll'.
.„....•
Pf3rith 34TR- * q,kUT
495-44) 4 S974
9 6 -if
lbart-T, mc't
6Clqf
cclii qf ffitzr
p
:
1032 RPH Sa.Vidhaika_Data I
LA1'4' '710 •CA-- -.;-.--nlr"-;6' • • - - 1—

_ anoxéfieim Em NS.
Ewgwgfigé
E.gfifir5%5wwmfivfimw¢umwgfi
”.ENEWEE‘EFanEEMEuE
HELEEEEEBE
ywfifiwwfiflwfifirwufivgfiflg.
EEEwEEEEwEa 3
I5 Ea fig
EEKVEE
‘om finsmmmwm
5. fix Em WEN W WE» Eh... .35pr E E E
Em w
,. IfiErmwfiflrflflsEEFmEE ESE
wgmrmmgfiflwfiazgflfifiégfiwwfiflgfl Imm Ewgcfica
88 fig 3 M? E E Em . . ; ON
.Imm Efiwwfi”
~
TraTT 31-CRITITTI quId. 28 WWI, 2009 21
40— (i) fl *HON fth—fil Ted91-4 MA VcM, 111:MTO, alMar
arra-A gi-Tr ftbr .friTti arfeficr4 * wraw.T.
cbeir A 4 arrtsr A fflitz 7E7. tO 3S1
i5 g. •Ar& trftftry, 7frit4 AT 414 wr 4 M. ft7t
34T4Vti-45 i ti4Wk wi1 sm4 0,1 :
-- tA
Si*-1T * f4Ar-i 41 44 4
-flArfkrS trviA i $b 41 fiw wOrr
vgAr-A (-0 S3T4A laud- Tri waft autuu filN iuf
* *19-4 i 3Tigf Win w4AT
vgy.A3T (i)* 31111A fit awkA tR -gitucitr A mfr 3IT4R
wi aiitifi A-M.4 wrz1-41 ft Aqvuu (1) A Thitz
14491-r 9t 2if 3TP-T4T 'TWA 7 cfrmr 3Teara ri /1 I
srd cnroft
, APT A Agivt i 44 gio 4,1c1 ITRIT n kmcil t 1 3-4, .P1
A arqacCi-4 344S$ f5 1-191.4 cfq Urftr TruftAr ftfri ardifu aT341
tb-R-M 4174 t amA 3TEA4A 4ucti -4A- j1 iat tuf•tict; I 1M.1 7Tur 4,14 far114,..iidu 91,9 t,
FRTiy arfit trr tur4 liTtIT 3.1 alargA aritel m4 *)1=4 qiel al-1W *fir'r7 awit -AT
3Tc2R1- 30 3*i4 3T7fATA writ 4 ‘fill q-r xkl& ard74 faAtia f4,41r
Itzfr tfj,Jrcw Ft:4T Thief A Fitg1,3, 34-4-4741 fazardweie tcI tutrAr 714 ftTflt
aTITOt 4Thi th—Mit. aiarr7A 4A. * gigr 1 /43—icr 7-ar ttj -A4-$T 4.A7A-ei4
cisi1P1 likVf 31741-1:51Tift 9zaraciicitl ft/1W, 2009 7: TeAf4u f ti
augr
vART cromcnbr,
No: 493(2)/LJOUX-V-1-09- I (ka)9-2009
Dated Lucicnow, February 28, 2009
In pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is
pleased, to order the publication of the following • english translation of the Uttar Pradesh Arbi Farsi
Vishwavidyalaya Adhiniyam, 2009 (Uttar Pradesh Adhiniyam Sankhya 12 of 2009) as passed by the Uttar
Pradesh Legislature and assented by the Governor on February 27, 2009.
THE UTTAR PRADESH ARABI PHARSI UNIVERSITY
ACT, 2009
(1.1.P. Act no. 12 of 2009)
[As passed by Uttar Pradesh Legislature]
ACT
' To provide for the eltablishment of an Arabi-Pharsi University at Lucknow in Uttar Pradesh for
teaching and research in Urdu Arabi and Pharsi languages and to provide for matters connected therewith
.ohincidental. thereto.
ET IS HEREBY enacted in the Sixteeth year of the RePublit of India as follows :—
CHAPTER-I
PRELIMINARY
I. (1.) This Act may be called the Uttar Pradesh ARABI PHARSI UNIVERSITY
ACT, 2009
- (2) It shall come into force on, such date as the State Government may, by
notification in the Gazette, appoint.
(?)
(.3)
5 0ft title„
° nloPecmcnt
32 RPH Sa.Vidhaikafiata I

3313331331313311332811333 2009 ' 21
“51333111333333 40—,(1) 31331333333333.33333333333313331
311331m2131333133331333311313111133333331
.‘ . 33313333113313f3fi131221331333m-fi3m1
“-3 ' 1333333333313313333211333333313333
'“‘ 33333333333333 91111333:
. '93“ ”mm-"*- '- 1113 31,1 31131321113 1113131 1:13 3 1m 3} 21 erg 2,1,»,
' W$WW3§333133133131331
“’3' (21'3qu (1)3333321111311133311331331311311333
-’ . " 3331133311wa11313ravnl
, (3)33113110331331331131133131333313311333m
... , .3333131133.3fi313313m(1)3fif3133133r‘
‘- 33333333333333333313333331
33331133313111
.. 331333333133333113313333313131333333133 13333133331131
33333333333333133333133331333331133131313331311-1313331‘11
31333333333333333133133333331313331333331313133333133433
mammmWfimawwmmfimmmm3ma3mfi
3333333333333333333333333333333331333331333331331
'fiswmm1133wfiwm3—mfiwfi3m3mafimmfim1
33313331133333313313133333333333333331333333333333331
311121133131
3333133313333113—3331333331321133113, 200933: 13113313313331
31131 3,
"' 1 ‘ . v 31321 |
No: 493(2)/LXXIX-V-1-09-1(ka)9-2009
Dated Lucknow. February 28, 2009
l
1 __
1‘ In pursuance of the provis1ons of clause (3) of Anicle 348 of the Constitution, the Governor is
pleased to order the publication of the following- english Kranslauon of the Uttar Pradesh Arbi larsi
5 Vishwavidyalaya Adhimyam 2009 (Ullar Pradesh Adhiniyam Sankhya 12 of 2009) as passed by the Ullar
Pradesh Legislature and asscmed by the Governor on February 27 2009.
THE UTTAR PRADESH ARABI PHARSI UNIVERSI FY
Am, 2009
1' , . ‘ . (U11. Act no. 12 012009)
[As passéd by Ullar Pradesh Legislamre]
' ' ' 'AN
ACT
T 0 provide for the establishment of an ArabI-Pham Universny a1 Lucknow in Uttar Pradesh for
“Ching and rexearch in Urdu Arabz and Pharsi languages and 10 provide for matters connected therewith
, nc1den1a1-1hereto.
CHAPTER-I
1W!
1. (1.) This Act may be called the Uttar Pradesh ARAB] PHARSI UNIV]: RS]' 1 Y
ACT, 2009_
1 (2) 11 shall come -imo force on. such date as the Slate Govemmcnl may, by
notification in the Gazette, appoint.
; 4th
22 STP( WAi %Mx-tit-Mut .tut
LO 4..QUJ
2. In this Act, unless the context otherwise requires:-
'Academic Council', 'Court' and 'Executive Council' mean respectively
the Academic Council, the Court and the Executive Council of nit ;
University;
'affiliated college' means an institution affiliated to the University th , )
accordance with the provisions of this Act or the Statutes of the university;
'associated college' means any institution recognised by the University;
'faculty' means a faculty of the University;
'hall' (or college) of the University means a unit of residence for students,
maintained or recognised by the University at which provision is made for
imparting tutorial and other supplementary instructions;
'hostel' of • the University, means a unit of residence for studentS
maintained or recognized by the University, other than hall, and hostel of ‘
an affiliated or associated college means a unit of residence for students of ,
that college;
'prescribed' means prescribed by the statutes;
'principal', in relation to an affiliated, associated or a. constituent college,
means the head of such college ;
'registered graduate' means a graduate of the University;
,
'statutes', 'ordinances' and 'regulations' means respectively the statutes',
ordinances and regulations of the University; '
(II) 'teacher' means a person employed in the University or in an institute oi-'..
in a constituent, affiliated or associated college of the University;
(12) 'university' means the Uttar Pradesh ARABI- PHARSI UNIVERSITY',
established under section 3.
CHAPTER-II
THE UNIVERSITY
3.. (1) There shall be established at Lucknow in Uttar Pradesh by the name of the
Uttar Pradesh Arabi Pharsi University.
The University shall be body corporate:
The object of the university shall be to provide advance knowledge and wisdom
and understanding by teaching and research of Urdu. Arbi and Pharsi languages to
the scholars.
The University shall be open to all persons irrespective of class or creed, but
nothing in this section shall be deemed to require the University to admit to
course of study a larger number of students than may be determined by the
ordinances:
Provided that nothing in this section shall be deemed to prevent t1I8
University from making special provisions for admission of studenls
belonging to the Scheduled Castes, the Scheduled Tribes or other backward classes
,
of citizen.
The University shall have the following powers and duties, namely -
to provide for instructions in such branches of learning as the Universil$:
may think fit, and to make provision for research and for' the advancement'
and dissemination of knowledge; ,
to admit any college to the privileges of affiliation or recognition antht0.
guide and control the work of affiliated and associated colleges;
to institute degrees, diplomas and other academic distinctions;
to hold examination for granting and confering degrees, diplomas
other academic distinctions to and on persons who-
have pursued, a course of study in the University. a constituent collagn
or an affiliated college. or associated college; or
have carried on research in' the University or in an institutio
n
1032 RPH Sa.Vidhaiku Data 1
Definitions
Establishment
and incorporation
of the University
Object of the
University
University open to
all classes and creed
Pnwr and duties of
the University
(2)
(I)
10
1

skit HQ?! omtqu ‘IutL, La «win. we;
i, ‘ Definitions 2. In this Act, unless the context otherwise requires:-
(1) 'Aeademie Council'. ‘Court’ and ‘Executive Council' mean respectively,
the Academic Council. the Court and the Executive Council of 1H“
University; " 7T
(2) 'affiliated college' means an institution affiliated to the University E,“ ,
, , accordance with the provisions of this Act or the Statutes of the university;) ' ‘x‘
(3) ‘associated college means any institution recognised by the University;
. (4) 'faculty' means a faculty of the University; _1
(5) 'Itall' (or college) of the University means a unit of residence for Student;
u maintained or recognised by the University at which provision is made fer
l . imparting tutorial and other supplementary instructions: \ ‘
.' ; (6) 'ltostcl' of ‘the University, means a unit of residence for Studcms' M
! : maintained or recognized by the University‘ other than hall, and hostel of , t
_ an affiliated or associated college means a unit of residence for students of “
1 that college: .
. (7) 'prescribed' means prescribed by the statutes; t
i {I . i (8) ‘prineipal'. in relation to an affiliated, associated or a. constituent college]
a; L means the head of such college ;
. : , (9) 'registcred graduate' means a graduate ofthe University; ‘1‘?“
‘ t 4 (10) 'statutes‘, 'ordinancos‘ and 'regulations' means respectively the statutesV ‘
fl . ordinances and regulations of the University; ' '3' ‘
t”: I (l 1) 'teacher' means a person employed in the University or in an institute 0%:
’ i' in a constituent, affiliated or associated college of the University; 1
t . ' . (12) 'university' means the Uttar Pradesh ARABI- PIIARSI UNIVERSITY;
' . ! i established under section 3. I
i ‘. l CHAPTER-II
; 1 THE UNIVERSITY _
-' ; .it; > ‘ ESXIF‘HSWWHII 3, (I) There shall be established at Lucknow in Uttar Pradesh by the name of the
- ‘ _ :2'l'1'3i3‘31'2i'3’" Uttar Pradesh Arabi Pharsi University.
* f . ' (2) The University shall be body corporate:
.: ‘I 0%“quth 4. The object of the university shall be to provide advance knowledge and wisdorti' u
' ‘- 't un'vm‘w ‘ and understanding by teaching and research of Urdui Arbi and Pharsi languages to, _
.l ' the scholars.
i Univmi‘y Wm” 5. The University shall be open to all persons irrespective of class or creed, bill
I “masses “‘1 “Md nothing in this section shall be deemed to require the University to admit to an) '
course of study a larger number of students than may be determined by the
ordinances:
Provided that nothing in this section shall be deemed to prevent tile
University from making special provisions for admission of smdénts
belonging to the Scheduled Castes, the Scheduled Tribes or other backward clasSCS'
1 . of citizent
: ”BMW? dUtiCS "r 6. The University shall have the following powers and duties. namely —
, . v the University ‘ ;
I “- (l) to provide for instructions in such branches of learning as the Universi‘Yr
may think fit. and to make provision for research and for' the advanccmtfmf
and dissemination ofknowledgc; ti
.
. (2) to admit any college to the pnvtlcges of affiliation or recognition anstO. _ ‘
' guide and control the work of affiliated and associated colleges; “
1‘ , (3) to institute degrees, diplomas and other academic distinctions;
(4) to hold examination for granting and confering degrees, diploma
other academic distinctions to and on persons who-
I . ~. (a) have pursued, a course of study in the University. a constituent 60““?-
‘ .
s and
.
or an affiliated college. or associated college: or t u
(b) have carried on research in' the University or in an instllu“°
l032 RPH Sa.Vidlt:tikuuData |
314.<1 Olt1It4IX.1 'WM, a tir(Ci, 2UU9 23
recognised in that behalf by the University or independently, under
conditions laid down in the statutes and the ordinances; or
(c) have pursued a course of study by correspondence whether residing
within the area of the University or not. and have been registered by
the University, Subject to such conditions as may be laid down in the
statutes and Ordinances as external candidates; or
(d). are teachers orothet employees in the University or in an Institute or in
a constituent or affiliated or associated college or in any other
educational institutions under conditions laid down in the statutes
and the ordinances or are inspecting officers permanently employed
in the Department of Education of the State Government, are
eligible and have carried on private studies under conditions laid
down in the' statutes and the ordinances; or
( e) are women and are.eligible and have carried on private studies under
conditions laid dchln in the statutes and ordinances; or .
(0
are blind and are eligible and have carried on private studies under
cimelitions laid dowin in the.statutes and the ordinances:
to hold .examinations for and to grant the degree of the University to the
persons under conditions .laid down in the .statutes and the ordinances.
(6) to confer honorary degree or other academic distinction in the manner and
under conditions laid down in the statutes:
(7). to grant such diplomas to and to provide such lectures and instructions, for
persons, not being students of the University, as the University may
determine;
to co-operate or collaborate with other Universities and authorities in such
manner and for suet] puiposes as the University may determine;
tO institute leaching posts reqUired .by the University and to appoint persons
to such post.
to recognize teachers for giving instruction in halls;
to lay down the conditions of affiliation or recognition of colleges and to
satisfy itself by periodical inspection and otherwise that those
conditions are satisfied;
to institute and award scholarships, fellowships (including traveling
fellowship), studentships and prizes in accordance with the statutes and the
ordinances;
to institute and maintain halls and hostels and lo recognize places of residence
for students of the University, the Institutes or the constituent or associated
colleges affiliated; or
to demand and receive such fees. and other charges as maybe fixed by the
ordinances;
to supervise and control the residence and to. regulate the discipline of
students of the University, the Institute and the constituent or affiliated or
associated colleges and to make arrangements for promoting their health:
to create administrative,, ministerial and other necessary posts and to make
appointments thereto: and
to do all such acts and things, whether incidental to the powers aforesaid or
not as may be required in order to' further the objects of the University.
CHAPTER-III
OFFICERS OF THE UNIVERSITY
Officer of thc 7. The following shall be the officers of the University;
University
(a) the Chancellor
1032 RN-I Sa.Vidhaika_Data I
(5)

mm mm omirmvi mac, as mom, 2009 23
1
recognised in that behalf by the University or independently, under .
conditions laid down 1n the statutes and the ordinances; or
(e) have pursued a course of study by correspondence whether residing
within the area of the University or not. and have been registered by
the University, subject to such conditions as may be laid down in the
statutes and Ordinances as external candidates; or
(d) are teachers or'other employees in the University or in an Institute or in
a constituent or affiliated or associated college or in any other
i- " ., educational institutions under conditions laid down in the statutes
1 1 , and the ordinances or are inspecting officers permanently employed
in the Department of Education of the State Government are
eligible and have carried on private studies under conditions laid
down in the statutes and the ordinances; or
.. 1" 1 ( e) are women and are eligible and have carried on private studies under
conditions laid down in the statutes and ordinances; or .
_ V (f) are blind and are eligible and have carried on private studies under
«’ . ' conditions laid down in the statutes and the ordinances:
' (5) to hold examinations for and to grant the degree of the University to the
persons under conditions laid down in the .statutes and the ordinances.
» ,- (6) to confer honorary degree or other academic distinction in the manner and
under conditions laid down in the statutes:
_ (7). to grant such diplomas to and to provide such lectures and instructions for
1. I . persons not being students of the University as the University may
' determine;
‘ (8) to co~operate or collaborate with other Universities and authorities in such
i i ' ' ' _ manner and for such purposes as the University may determine;
' . ' ‘ ' (9) to institute leaching posts required by the University and to appoint persons .
to such post ‘ ”
(10) to recognize teachers for giving instruction in halls;
r. (1 l) to lay down the conditions of affiliation or recognition of colleges and to
satisfy itself by periodical inspection and otherwise that those
V . . _ conditions are satisfied;
, > (12) to institute and ,award scholarships, fellowships (including traveling
. fellowship) studentships and prizes in accordance with the statutes and the
if ' ordinances:
I (13) to institute and maintain halls and hostels and lo recognize places of residence
. " ‘ for students of the University, the lnstitutes or the constituent or associated
' _ colleges affiliated; or i
i , -’ I (14) to demand and receive such fees and other charges as may be fixed by the
ordinances;
(15) to supervise and control the residence and to regulate the discipline of
students of the University, the Institute and the constituent or affiliated or
associated colleges and to make arrangements for promoting their health:
‘ , V (16) m create administrative, ministerial and other necessary posts and to make
appointments thereto and
i j. _ (17) to do all such acts and things whether incidental to the powers afomsaid or
not as may be required in order to further the objects of the Universitv.
CHAPTER- III
OFFICERS OF THE UNIVERSITY
" 0mm 0‘th 7. The following shall be the officers of the University ; ~-
University
(a) the Chancellor
"’32 KPH SuiVidhaika_Data l
'
I
TIT
24
‘31-K 14 Yr STiilliNtriIluiC 28 1:57ifql, 2009
the Vice Chancellor;
the Finance Officer;
the Registrar; •
the Controller of Examinations;
the Deans of Facilities;
(h) such other officers as may be declared by the Statues to be the officers of the,
University.
The Chancellor 8. (1) The Governor shall be the Chancellor of the University. He shall, by virtue
of his .office, be the Head of the University and the President
of the court and shall, when present, preside at meeting the court and af
any convocation of the University.
Every proposal for the conferment of an honorary degree shall be subject to
the confirmation of the Chancellor.
It shall. be the duty of the Vice-Chancellor to furnish such information or
records relating to the administration of the affairs of the University a
the Chancellor may call for.
The Chancellor shall have such other powers as may be conferred on him
by or under this Act or the statutes.
The Vice Chancellor 9. (1) The Vice Chancellor shall be a whole-time salaried officer of the
University and shall be appointed by the Chancellor from amongst the
persons whose names are submitted to him by the committee
constituted. in accordance with the provisions of sub-section (2).
(2) The committee shall consist of the following members, namely :—
One person (not being a person connected with the University, an
Institute, a constituent college, an associated or affiliated college
or a hall or hostel) to be elected by the Executive Council (at
least three months before the date on which a vacancy in the .
office of the Vice-Chancellor is due to occur by reason of expiry.,
of his term);
One person who is or has been a Judge of the High Court Of:
Judicature at Allahabad nominated by the Chief Justice; and
One. person to be nominated by the Chancellor who shall also be
the convener of the committee :
Provided that where the Executive Council fails to elect
any person in accordance with clause (a), then the Chancellorr.,
shall nominate in addition to the person nominated by him ,
under clause (c), one person in lieu of the representative of the-
Executive Council.
(3) The comrnittee, shall, as far as may be. at least sixty days before the date on
which a vacancy in the office of the Vice-Chancellor is due to occur 111
reason of expiry-of term or resignation under sub-section (7) and also,
whenever so required and before such date as may be specified by the
Chancellor, submit to the Chancellor the names of not less than thrS
and not more than five persons suitable to hold the office of the Vice
Chancellor. The committee shall, while submitting the names, als°
forward to the Chancellor a concise statement showing the academit
1032 12F11 Sa Vidhaika_Data 1

"924" on? new warm W, 28 watt. 2009
(b) the Vice Chancellor; m
(c) the Finance Officer;
(d) the Registrar ; - H V
(e) the Controller of Examinations;
(f) the Deans of Facilities;
(h) such other officers as may be declared by the Statues to be the officers 0fth
University. '
The Chancellor 8. (1) The Governor shall be the Chancellor of the University. He shall, by virtue“:
of his .office,‘ be the Head of the University and the Prcsidcn
of the court and shall, when present, preside at meeting the court and at
any convocation of the University. > \
(2) Every proposal for the conferrnent of an honorary degree shall be subject to‘
the confirmation of the Chancellor.
(3) It shall be the duty of the Vice-Chancellor to furnish such information of. ‘
records relating to the administration of the affairs of the University as
the Chancellor may call for.
(4) The Chancellor shall have such other powers as may be conferred on him I,
by or under this Act or the statutes. '
The Vice Chancellor 9. (1) The Vice Chancellor shall be a whole-time salaried officer of the
University and shall be appointed by the Chancellor from amongst the:
persons whose names are submitted to him by the committee '
constituted in accordance with the provisions ofsub-section (2).
(2) The committee shall consist of the following members, namely :~
(a) One person (not being a person connected with the University, _an' '
Institute, a constituent college, an associated or affiliated college - '
or'a hall or hostel) to be elected by the Executive Council (at '
least three months before the date on which a vacancy in the
office ofthe Vice-Chancellor is due to occur by reason ofexpiry‘
of his term);
(b) One person who is or has been a Judge of the High Court of ‘.
Judicature at Allahabad nominated by the ChiefJustice; and
(c) One person to be nominated by the Chancellor who shall also be
the convener ofthe committee : '
Provided that where the Executive Council fails lo elcCE,
any person in accordance with clause (a), then the Chancellor,.
shall nominate in addition to the person nominated by him
under clause (e), one person in lieu of the representative of’ thew
Executive Council.
(3) The committee, shall, as far as may be. at least sixty days before the date 0 g
which a vacancy in the office of the Vice-Chancellor is due to occur W -' i (t
reason of expiry—of term or resignation under sub—section (7) and also; 1
whenever so required and before such date as may be specified by (he, ’
Chancellor. submit to the Chancellor the names of not less than the
and not more than five persons suitable to hold the office of the V1"c
Chancellor. The committee shall, while submitting the names, Bis,"
forward to the Chancellor a concise statement showing the academ‘,
1032 RPH Sa Vidhaika_Data l
qualifications and other distinctions of each of the persons 'so
recommended, but shall not indicate, any order of preference. •
Where the Chancellor does not consider any on or more of persons
recommended by the Committee to be suitable for appointment as Vice-
Chancellor or if one or more of the persons recommended is or are not
available for appointment and the choice of the Chancellor is restricted
to less than three persons, he may require the Committee to submit a list
of fresh names in accordance with sub-section (3).
If the Committee in the case referred to in sub-section (3) or sub-section
(4) fails or is unable to suggest any names within the time specified by
the Chancellor, or if the Chancellor does not consider any one or more
of the fresh names recommended by the Committee to be suitable for
appointment, as Vice-Chancellor another Committee consisting of three
persons of academic eminence shall be constituted by the Chancellor
which shall submit the names in accordance with sub-section (3).
No act or proceeding .of the committee shall be invalidated merely by
reason of the existence of a vacancy or vacancies among its members or
by reason of some person having taken pan in the proceedings who is
subsequently found not to have been entitled to do so.
(a) Only such persans shall be eligible for apointment to the office of
Vice-Chancellor who has not attained the age of sixty five years;
the Vice-Chancellor shall hold office for a term of three years from
the date on which he enters upon his office or till he attains the age of
sixty eight years whichever is earlier;
The Vice-Chancellor who has not attained the age of sixty fore years
may be appointed as such for second Terms:
Provided that the Vice-Chancellor may by writing under his hand
addressed to the Chancellor resign, his office, and shall cease to hold his
office on the acceptance by the Chancellor of such resignation.
(8). Subject to the provisions of this Act, the emoluments and other conditions
of service of the Vice-Chancellor shall be such as may be
determined by the State Government by general or special order in that
behalf.
The Vice-Chancellor shall not be entitled to the benefit of any pension.
insurance 'or provident fund constituted under section 33 of the State
University Act. 1973: •
Provided that when any teacher or other employee of any
University or any affiliated or associate college is appointed as Vice-
Chancellor, he shall be allowed to continue to contribute to the
provident fund to which he is a subscriber and the contribution of the
University shall be limited to what it had been contributing immediately
before his appointment as Vice-Chancellor.
In any of the following cireumstances (of the existence of which the
Chancellor shall be the sole judge), the Chancellor may appoint any
suitable person to the office of Vice-Chancellor for a term not exceeding
six months as he may specify :—
(a) Where a vacancy 'in the office of Vice-Chancellor occurs or is
likely to occur by reason of leave or any other cause, not being
resignation or expiry of term of which a report shall forthwith be
made by the Registrar to the Chancellor;
1032 RPA Sa.Vidhailca_Data I

,Iv
Ion ttPH Sa.Vidhaikn_Data I
qualifications and other distinctions of each of the persons '50
recommended, but shall not indicate, any order ofprefcrence.
(4) Where the Chancellor does not consider any on- or more of persons
recommended by the Committee to be suitable for appointment as Vice-
Chancellor or if one or more of the persons recomrncrtdcd is or are not
available for appointment and the choice of the Chancellor is restricted
to less thatt three persons. he may require the Committee to subtnit a list
of fresh names in accordance with sub-section (3).
(5) If the Committee in the case referred to in sub-section (3) or sub-section
(4) fails or is unable to suggest any names within the time specified by
the Chancellor, or if the Chancellor does not consider any one or more
of the fresh names recommended by the Committee to be suitable for
appointment, as Vice-Chancellor another Committee consisting of three
persons of academic eminettee shall be constituted by the Chancellor
which shall submit the names in accordance with sub-section (3).
(6) No act or proceedingof the committee shall be invalidated merely by
reason of the existence of a vacancy or vacancies among its members or
by reason of some person having taken pan in the proceedings who is
subsequently found not to have been entitled to do so.
(7) (a) Only such persans shall be eligible for apointment to the office of
Vice-Chancellor who has not attaitted the age ofsixty five years;
(b) The Vice-Chancellor shall hold office for a term of three years from
the date on which he enters upon his office or till he attains the age of
sixty eight years whichever is earlier;
(c) The Vice-Chancellor who has not attained the age of sixty fore years
may be appointed as such for second Temts:
Provided that the Vice-Chancellor may by writing under his hand
addressed to the Chancellor resign, his office. and shall cease to hold his
office on the acceptance by the Chancellor of such resignation)
(8). Subject to the provisions ofthis Act, the emoluments and other conditions
of service of the Vice-Chancellor shall be such as may be
determined by the State Government by general or special order in that
behalf ‘
(9) The Vice-Chancellor shall not be entitled to the benefit of any pension,
insurance or provident fund constituted under section 33 of the State
University Act. 1973: -
Provided that when any teacher or other employee of any
University or any affiliated or associate college is appointed as Vice-
Chancellor, he shall be allowed to continue to contribute to the
provident fund to which he is a subscriber and the contribution of the'
University shall be limited to what it had been contributing immediately
before his appointment as Vice-Chancellor.
(10) In any of the following circumstances (of the existence of which the
Chancellor shall be the sole judge), the Chancellor may appoint any
suitable person to the office of Vice-Chancellor for a term not exceeding
six months as he may specify 2— '
(a) Where a vacancy 'in the office of Vice-Chancellor occurs or is
likely to occur by reason of leave or any other cause, not being
resignation or expiry of term of which a report shall forthwith be
made by the Registrar to the Chancellor;
Prin-71(
I.
I 313:1111Ru1 livid. 28 1:Mt. 2009
4..
Powers and duties of
the Officers
Authorities of the
University
Constitution of the
Executive Council,
Where a vacancy in the office of Vice-Chancellor occurs and i
cannot be. conveniently and expeditiously filled in accordance
with the provisions of sub-sections (1) to (5);
Any other emergency:
Provided that the Chancellor may. from time to time
extend, the term of appointment of any person to the
office of the Vice-Chancellor under this sub-section, so
however, that the total term of such appointment including:
the term fixed in the original order does not exceed one year.
(II) Until a Vice-Chancellor appointed under sub-section (1) or sub-section (5y,K.
or sub-section (10) assumes office, the senior most Professor of the
University shall discharge the duties of the Vice-Chancellor as well.
If in the opinion of the Chancellor, the Vice-Chancellor willfully omits or
refuses to carry out the provisions 'of this Act or abuses the powers .
vested in him, or if it otherwise appears to the Chancellor that the 4
continuance of the Vice-Chancellor 'in office is detrimental to the
interest of the University, the Chancellor may after making such inquiry
as he deems proper, by order, remove the Vice-Chancellor.
During the pendency, or in contemplation, of any inquiry referred to in
sub-i.e.:nu .1 (12) the Chancellor may order that till further orders
(a)
Such Vice-Chancellor shall refrain from performing the functions
of the office of Vice-Chancellor, but shall continue to get the ,
emoluments to which he was otherwise entitled under sub-
section (8);
(h) The functions of the office of the Vice-Chancellor shall be
'
performed by the person specified in the order.
10 The powers and duties of the Finance Officer, the Registrar, the Controller of
Examination, the Deans of Faculties and other officers of the University shall.
be such as may be prescribed.
CHAPTER-IV
AUTHORITIES OF THE UNIVERSITY
The following shall be the authorities of the University:
the Executive Council ;
the Court;
the Academic Council ;
the Finance Committee;
the Faculties ;
the Admissions Committee;
the Examination Committee ;r. 1
such other authorities as may be declared by the Statues to be authorities of
the University.
(1) The Executive Council shall consist of:—
The Vice-Chancellor, who shall be the Chairman thereof;
The Deans of two Faculties by rotation in the manner as prescribed/
by the statues of the University.
1032 RPH Sa.Vidhaika_Data I

Powers and duties of IO The powers and duties of the Finance Officer, the Registrar, the Controller of" i f
the Officers
Authorities ofthc
University
Constitution of the
Executive Council.
1032 RPH SalvidhaiktLData |
am ne’er W m, 28 we, 2009
cannot becom'eniently and expeditiously filled in “ccnrdanoc ,
with the provisions ofsub-sections (l) to (5);
(c) Any other emergency:
Provided that the Chancellor may. from time to lime, . x
extend, the term of appointment of any person to their
office of the Vice-Chancellor uttder this sub—section. 50,,
however. that the total term of such appointment including;
the term fixed in the original order does not exceed one year, t .
(l 1) Until a ViccAChanccllor appointed under sub-section (1) or sub-section (5)}
or sub-section (l0) assumes office, the senior tnost Professor of ”to
University shall discharge the duties of the Vice—Chancellor as well. .
(l2) lfin the opinion ofthe Chancellor, the Vice-Chancellor willfully omits 0r} ‘
refuses to carry out the provisions‘of this Act or abuses the powers:
vested in hint, or if it otherwise appears to the Cltancellor that the
continuance of the Vice-Chancellor'in office is detrimental to the \ ‘.
interest of the University, the Chancellor may after making such inquiry;
as he deems pmper. by order, remove the Vice-Chancellor. '
(13) During the pendency, or in contemplation, of any inquiry referred to in g.
sub—:teetit 't ( l 2) the Chancellor may order that till further orders :— f
(a) Such V ice-Chancellor shall refrain from performing the functions
of the office of Vice‘Chaneellor, but shall continue to get the i.
emoluments to which he was otherwise entitled under sub i L
section (8); ‘ ,
(b) The functions of the office of the Vice—Chancellor shall be -‘
performed by the person specified in the order.
Examination, the Deans of Faculties and other officers of the University shall-1
be such as may beprescribed I
CHAPTER-IV
AUTHORITIES OF THE UNIVERSITY
The following shall be the authorities of the University :
i
*1
ti
3
the Executive Council ;
the Court;
the Academic Council ;
the Finance Committee; _ }
the Faculties ;
the Admissions Committee ;
the Examination Committee a n 1
such other authorities as may be declared by the Statues to be authorities of - ,
the University, '
(l) The Executive Council shall consist of :-
(a) The Vice-Chancellor, wlto shall be the Chairman thereof: i
(b) The Deans of two Faculties by rotation in the manner as prescribfidJ ,
by the statues of the University.
Powefsond dillies of
Executive Council
\nu gbr 3MMTRUT Rri , 28 97&t1, 2009 27 .
(2) (a) Two Professors [other than a Dean referred to in clause (b) of sub-
section (1) two Readers and two Lecturers of the University, to be
selected in such manner as may be prescribed:
(b) One Principal of an affiliated college to be selected in such manner
as may be prescribed.
Four persons to be elected by members of the Court from amongst such
of them as • are not enrolled as students of or in the service of the
University or an Institute or of a constituent college or an affiliated or
associated college or hall or •li• )stel.
(4) (a) Four persons of academic eminence to be nominated by the
Chancellor;
(b) One person, from amongst the reputed industrialists who have made
valuable contribution in the field of higher education to be
nominated by the State Government:
„Provided that one of the persons to be nominated under this
.-sub-section shall be a person who is or has been a Judge of the
Supreme Court or High Court.
The term of office of members shall be such as specified in the statutes
and ordinances of the University. •
No person shall be a member of the Executive Council for more than two
consecutive terms. •
Notwitlislanding anything contained in any other provision of this Act, no
person shall be elected or nominated as a member of the Executive
Council unless he is a graduate.
A pers- on shall be disqualified for being chosen as and for being, a .
member of the Executive Council if he or his relative accepts any
remuneration for any work in or for the University or any contract for
the supply of goods- to or for the execution of any work for the
University:
Provided that nothing in this sub-section shall apply to the
acceptance of any remuneration by a teacher as such or for any duties
performed in connection with an examination conducted by the
University or for any duties as Superintendent or Warden of a training
unit or any hall or hostel or proctor or tutor for any duties of a similar
nature in relation to the University.
Explanation :— In this section 'relative' means the relations
defined in section 6 of the Companies Act, 1956 and. includes the
wife's (or husband's) brother, wife's (or husband's) father, wife's (or
husband's) sister, brother's son and brother's daughter.
13 . (1) The Executive Council shall be the principal executive body of the
University and subject to the provisions of this Act have the f011owing
powers, namely -
to hold and control the property and funds of the University;
to acquire or transfer any movable or immovable property on
behalf of the University;
to make, amend or repeal Statutes and Ordinances;
to administer any funds placed at the • disposal of the
University for specific purposes,.
to prepare the budget of the University;
(3)
(5)
9idhailth_Daut I

Pawn-is and duties of
Executive Council
,13.
an? m mm were. 28 was). 2009 ' 27 .
(2) (a) Two Professors [other than a Dean referred to in clause (b) of sub-
section (1) two Readers and two Lecturers of the University, to be
selected in such manner as may be prescribed:
(b) One Principal of an affiliated college to be selected in such manner
as may be prescribed.
(3) Four persons to be elected by members of the Court from amongst such
of them as- are not enrolled as students of or in the service of the‘
University or an Institute or of a constituent college or an affiliated or
associated college or hall or it lSlCi
(4) (a) Four persons of academic eminence to be nominated by the
Chancellor;
(b) One person, from amongst the reputed industrialists who have made '
valuable contribution in the field of higher education to be
nominated by the. State Government :
Provided that one of the persons to be nominated under this
'sub section shall be a person who is or has been a Judge of the
Supreme Court or High Court
(5) The term of office of members shall be such as specified in the statutes
and ordinances of the University
(6) No person shall be a member of the Executive Council for more than two
consecutive terms
(7) Notwithstanding anything contained In any other provision of this Act no
person shall be elected or nominated as a member of the Executive
Council unless he 15 a graduate
(8) A person shall be disqualified for being chosen as and for being, a
member=of the Executive Council if he or his relative accepts any
remuneration for any work in or for the University or any contract for
the supply of goods' to or for the execution of any work for the
University:
Provided that nething in this sub- section shall apply to the
acceptance of any remuneration by a teacher as such or for any duties
performed in connection with an examination conducted by the
University or for any duties as Supenntendent or Warden of a training
unit or any hall or hostel or proctor or tutor for any duties of a similar
nature in relation to the University.
Explanation :— In this section 'relative' means the relations
defined in section 6 of the Companies Act 1956 and. includes the
wife's (or husbands) brother wifes (or husband's) father, wife's (or
husband‘s) sister brother’ 5 son and brother's daughter.
(1) The Executive Council shall be the principal executive body of the
University and subject to the provisions of this Act have the following
powers, namely- '
(i) to hold and control the property and funds of the University;
(ii) to acquire or transfer any movable or immovable property on‘
behalf of the University;
(iii) to make, amend or repeal Statutes and Ordinances ;
(iv) to administer any funds plaee'd at = the‘ disposal of the
University for specific purposes;
‘ (v) to prepare the budget of the University;
1032 RPH Sa.Vidhaikapata 1
c3te1:c CA01. citilluixot 'I V1L. 40 ,
,,• t .4,
(VI)
to award scholarship. fi:Ilowships, bursaries, medals and othe
rewards in accordance iisith the Statutes and Ordinances:
to appoint offic::o.i. :eachers and other employees
of the
University and to define their duties and the conditions of
their servi,:e,
to provide for the filling of temporary
casual vacancies in their posts
to fix the fees, emoluments and travelling and other allowances '
of the examiners;
to admit any college to the privileges of affiliation or recognition;
to arrange for and direct the inspection of Institutes, affiliated,
associated or constituent colleges. halls, hostels and other
places of residence of students ;
to direct the form and use of the common seal of the University;
to regulate and enforce discipline among members of the
teaching, administrative and other staff of the University in
accordance with the Statutes and the Ordinances ; •
to manage and regulate the finances, accounts, investments,
property, business and all other administrative affairs of the
University, and for that purpose, to appoint such agents as it
may think fit;
to invest any money belonging to the University:
to provide the buildings, premises, furniture and apparatus and
other means needed for carrying on the work of the
University;
to enter into, vary, carry out and cancel contracts on behalf of the
University;
to regulate and determine all other matters concerning the
University as well as Institutes, constituent, affiliated and
associated colleges in accordance with this Act the Statutes
and the Ordinances.
(2)
No immovable property of the University shall, except with the prior
sanction of the State Government, be transferred (except by way of
letting from month to month in the ordinary course of management) by
. C:
the Executive Council by way of mortgage, sale, exchange, gift or
otherwise nor shall any money be borrowed, or advance taken on the
security thereof except as a condition of receipt of any grant-in-aid of the'
University from the State Government, or with the previous sanction of.
the State Government, from any other person.
(3) No expenditure in respect of which approval of the State Government is 4
.
required by this Act or di, ‘i mattes or Ordinances shall be incurred
except with such approval previously obtained, and no post shall he )
created either in the University or in any Institute or constituent colldge 4
maintained by the University except with the prior approval of the Staic
Government or except in accordance with any general or special order of
the State Government.
(4) The Executive Council may, with the prior approval of the University
Grants Commission and the State Government create supernumer
arY
post of teacher of the University with a view to enabling a teache
.1
Who is for the time being holding a responsible position of nation
-f"

~-
l032 RPH Sa.Vidhaika_Data l
BTW
__—_____.__._—-
(2) No immovable property of the University 5
(3) No expenditure in resp
'__._’————_~
(Mtllulxvt ‘IUIC‘ Ln mm t
A"
s, bursaries, medals and other it;
(vi) to award scholarshipr fellowship
d Ordinances:
rewards in accordance With the Statutes an
(vii) to appoint otficrvs. teachers and other employees of the ;;
Universny and to define their duties and the conditions of ‘.,
their Service: A to provide for the filling of temporary ‘u
casual vaezutcies in their posts 1
(viii) to fix the fees, emoluments and travelling and other allowanceS t,
of the examiners;
(ix) to admit any college to the privileges of affiliation or rccognitiom a
. . . t-
on ot Institutes, affiliated .t
‘ J ,.'
(x) to arrange for and direct the inspecti
halls, hostels and other i”
associated or constituent colleges.
places of residence of students ;
(xi) to direct the form and use of the common seal of the University;
(xii) to regulate and enforce discipline among members of the 1
teaching, administrative and other staff of the University in
accordance with the Statutes and the Ordinances ;.
vestrncnts,
(xiii) to manage and regulate the finances. accounts, in
dministrative affairs of the t: , A'
" l»,
l
property, business and all other a
University. and for that purpose, to appoin
may think fit;
{_
(xiv) to invest any money belonging to the University;
t such agents as it 3'
ses, furniture and apparatus and “f "
5
(xv) to provide the buildings. premi
other means needed for carrying
University;
on the work of the!
(xvi) to enter into: vary, carry out and cancel contracts on behalf of the .
University; J
matters concerning the . ‘
onstituent, affiliated and:
h this Act the Statutes
(xvii) to regulate and determine all other
University as well as lnstitutes, c
associated colleges in accordance wit
and the Ordinances
hall, except with the prior
sanction of the State Government, be transferred (except by way of 1
letting from month to month-in the ordinary course of management) by.
the Executive Council by way of mortgage, sale, exchange, gift of},
otherwise nor shall any money be borrowed. or advance taken on the ‘_
security thereof except as a condition of receipt of any grant-in—aid of thcj‘
University front the State G ' ction of"
ovemment, or with the previous san
the State Government, from any other person. 7,
ect of which approval ol‘the State Government 151 >
hall be incurred ‘-
‘s’tntutes or.Ordinances s
required by this Act or tht a
except with such approval previously obtained, and no post shall 1191‘ ‘ i
created either in the University or in any Institute or constituent collcgc
maintained by the University except with the prior approval of the 5m” f ‘
.
Government or except in accordance with any general or special 0rd?r 0‘
- 'l
the State Government,
(4) The Executive Council may, with the prior approval of the Uni
Grants Commission and the State Government create supemu
post of teacher of the University with a view to enabling a
who is for the time being holding a responsible position of n8
verSilX
merm’.
teaCh?‘. 7
tionll! I
.1
The Court
importance in India or abroad in educational administration or other
similar assignments, to retain his lion; arid seniority as such teacher
and also to continue to earn increments in his pay scale during the
period of his assignment and to contribute towards provident fund and
earn retirement benefits, if any. in accordance with the Statutes:
Provided that no salary shall be payable to such teacher by the
University for the period of such assignment.
The pay and other allowances to various categories of the employees of
the University Or of any Institute or constituent college or affiliated or
associated college shall be 'such as may be approved by the State
Government.
The Executive Council shall not exceed the limits of recurring and non-
recurring expenditure to be incurred in each financial year fixed by the
Finance Committee.
The Executive Council shall not take any action in regard to the number,
qualifications and emoluments of teachers, and. the fees payable to
examiners, except after considering the advice of the Academic Council
and the Boards of Faculties concerned.
The Executive Council shall give due consideration to every resblution of
the COurt, and take such action thereon as it shall deem fit and report to
the Court, the action taken or, as the case may be, the reasons for non-
acceptance of the resolution.
The Eiecutive Council may subject to any conditions laid down in the
Statutes, delegate such of its powers as it deems fit to an officer or any
other authority of the University, or to a Committee appointed by it.
14. (1) The Court shall consist of the following members, namely:—
Class I- Ex-Officio Members
the Chancellor who shall be the Chairperson;
the members of the Executive Council;
.(iii) the Finance Officer;
Class II- Life Members,
in the case of an existing University, every person who was a life
member of the Corm or Senate immediately before the
commencement of this Act;
Class-Ill- Representatives of teachers, etc.
all heads of departments of The University and of constituent,
colleges maintained by it;
two representatives of provosts and wardens of hostels and halls
of the University and of its constituent colleges and Institutes to
be selected by rotation in such manner as may be prescribed;
fifteen teachers ,to be selected in such manner as may be
prescribed;
two representatives of the managements of the affiliated or
associated colleges to be selected by rotation in such manner as
may be prescribed:
Class-IV -Registered Graduates
fifteen representatives of registered graduates to be elected, by
registered graduates of such standing as may be prescribed from .
1,032,11PH Se.Vidhaika_Data I

1! i_ u'
\
r.‘
importance in India or abroad in educational administration or other
similar assignments, to retain his lion and seniority as such teacher
and also to continue to earn increments in his pay scale during the
period ofhis assignment and to contribute towards provideni fund and
earn retirement benefits. if any. in accordance with the Statutes:
Proyided that no salary shall be payable to such teacher by the
University for the period of such assignment.
(5) The pay and other allowances to various categories of the employees of
the University or of any Institute or constituent college or affiliated or
associated college shall be such as may be approved by the State
Government .
(6) The Executive Council shall not exceed the limits of recurring and non—
recun'ing expenditure to be incurred in each financial year fixed by the
Finance Committee. _ .
(7) The Executive Council shall not take any action in regard to the number,
qualifications and emoluments of teachers, and. the fees payable to
examiners, except after considering the advice of the Academic Council
and the Boards of Faculties concerned. V "
(8) The Executive Council shall give due considei-ation to every resolution of
the Court. and take such action thereon as it shall deem fit and report to
the Court, the action taken or, as the case may be, the reasons for non-
acceptance of the resolution. '
(9) The EXecutive Council may subject to any conditions laid down in the
Statutes, delegate such of its powers as it deems fit to an officer or any
other authority of the University, or to a Committee appointed by it,
14. (l) The Court shall consist of the following members, namely :—
Class I- Ex-Oflicio Members
(i) the Chancellor who shall be the Chairperson;
(ii) the members of the Executive Council;
(in) the Finance Officer;
Class [1- Life Members,
(iv) in the case of an existing University, every person who was a life
member of the Court or Senate immediately before the
commencement of this Act;
Class-III- Representatives afreachers, etc.
(v) all heads' of departments of the University and of constituent,
colleges maintained by it;
(vi) two representafives of provosts and wardens of hostels and halls
of the University and of its constituent colleges and Institutes to
be selected by rotation in such manner as may be prescribed;
(vii) fifteen teachers ,to be selected in such manner as may be
prescribed; *
(viii) two representatives of the managements of the affiliated or
associated colleges to be selected by rotation in such manner as
may be prescribed: ,
Class-l V -Regislere(l Graduates
(ix) fifteen representatives of registered graduates to be elected. by
registered graduates of such standing as may be prescribed from
[032 RPH Sa,Vidhaika_Dala l
Powers and duties of
the Court
Meeting of the Court
Academic Council
CM,
iv tItic ntrci stntiptiot-
a.
amongst such of them as are not in the service of the University.
or of an Institute or of a constituent college or in the service
°!'
connected with the management of affiliated college. associateTd,
college, hall or hostel;
Class-V- Representation of Students •
one student from each of the Faculties, who having secured tie
highest marks in that Faculty at the preceding degr'ett,
examination of the University shall pursue a course of study 1'0[7
a postgraduate degree in the University.
Class-VI- Representatives of the State Legislature
two members of the Legislative Council to be elected by it;
(xii)five members of the Legislative Assembly to be elected by it.'
(2) The term of office, of members of each class, except Classes I. II arid V,
mentioned in sub-section (1) shall be three years and the term of dire
--members of the said class V shall be one year.
15. The Court shall be an advisory body subject to the provisions of this Act,"
shall have the following powers and functions, namely:—
(a) to review, from time to time, the broad policies and programmea
of the University and to suggest measures for the improvemcni • ,
and development of University;
(b) to consider and pass resolutions on the annual report the annual
accounts of the University and the audit report thereon:
(c) to advise the Chancellor in respect of any matter which may
referred to it foradvice; and
;s.
(d) to perform such other duties and exercise such other functions as.
may be aisigned to. it by this Act or the Statutes or by the
Chancellor.
16. (1) The Court .shall-meet once a year on a date to be fixed. by the Vice
Chancellqr and such meeting shall be called the annual meeting of ilia
Court.
(2) The, Vice-Chanaellor may, whenever he thinks fit and shall, upon;!
requisition in writing-signed by not less than -one-fourth of the toad
member of the Court, convene a special meeting of the Court.
17. (1) The Academic Council shall be the principal academic body of 111c
University and subject to the provisions of this Act the Statutes and tab
Ordinances -
shall have the control and general regulation of, and be responsibb 0
for the maintenance of standard of instruction, education ant
research carried on or imparted in the University;
may advise the Executive Council on all academic matt0 •
including matteis5relating to examinations conducted by rite
University; and
shall have such powers and duties as may be conferred or impos
upon it by the Statutes.
(2) The Academic Council stall consist of the following members, namely7
the Vice-Chancellor who shall be the Chairperson;
the Deans of all Faculties;
10
1032 RPH Sa.Vidhaikapata 1

JV \au‘ >1~<<1vn11~uv1 um», Lu 1I\-1\I, “NI
"5
‘1
‘ 1 :- amongst such of them as are not in the service of the Univmh;
i . or of an Institute or ofa constituent college or in the Service‘ or .
5 l ' connected with the management of affiliated college assoqamfl l 1
i l ‘ college, hall or hostel; ‘
Class- V- Representation of Students - ’ it“
l ‘ ' ' (x) one student from each of the Faculties who having secured the W
. highest marks in that Faculty at the preceding degrac .
' examination of the University shall pursue a course of study for
a postgraduate degree in the University. , . i "
l' l: . . ' , _ Class- VI- Representatives of the State Legislature
(xi) two members of the Legislative Council to be elected by it ;
(xii)five members ofthe LegislativetAssembly to be elected by it. ‘ .‘t l1
(2) The term of office of members of each class, except Classes l. [I and VI ‘
mentioned in sub— section (1) shall be three years and the term of the
members of the said class V shall be one year
Powers and duties of 15_ _ The Court shall be an advisory body subject to the provisions of this ACL'ii . g
‘hc CW“ ' shall have the following powers and functions, namely2— ‘ ‘ A
(a) to review, from time to time, the broad policies and programme; '1
of the University and to suggest measures for the improvemml , 1’
and development of the University , -
(b) to consider and pass resolutions on the annual report the annual '
i _ accounts of the University and the audit report thereon: ' l
1 .
l
‘ ' i (c) to advise the Chancellor in respect of any matter which may 3%,-
referred to it for‘advice; and '
(d) to perform such other dutie’s” and exercise such other functions as
may be assigned to'it by this Act or the Statutes or by the'
Chancellor ‘ -
M'W‘ing 0W“: CW“ 16. (l) The Court shall- meet once a year on a date to be fixed _by the Vice
Chancellor and such meeting shall be called the annual meeting of the: - " ‘
Court.
(2) The Vice-Chancellor may, whenever he thinks fit and shall upon :11
requisition in writing- signed by not less than one- -fourth of the toiiil' ‘ ‘,
member of the Court, convene a special meeting of the Court. ‘
Acfldmic Council 17. (l) The Academic Council shall be the principal academic body of the . '
University and subject to the provisions of this Act the Statutes and lit? ‘
Ordinances - ‘ "
(a) shall have the control and general regulation of and be responsiblb
for the maintenance of standard of instruction, education anti' 1'
rescarch carried on or imparted 1n the University; ‘ ‘
(b) may advise the Executive Council on all academic mad“? l ‘1
including matteis 5relating to examinations conducted by '|
University; and '
(c) shall have such powers and duties as may be conferred or 1mP°5 . 1 l
upon it by the Statutes. pg l
(2) The Academic Council stall consist of the following members namClY ‘1 ' l
,, 1
0
(i) the Vice-Chancellor who shall be the Chairperson: , . ‘
(ii) the Deans of all Faculties ;
1032 RPH Sa.Vidhaika_Da11i 1
The Finance
Committee
all Heads of Departments of the University;
all Professors of the University wit are not Heads of Departments;
.(v) the Principals of constituent colleges and the Directors,of Institutes;
two Professors. frdin each constituent college, if any by iotation'in
order of seniority to be determined in the manner pres4ibed;
three Principals of affiliated or associated colleges to be selected
bY rotation in the manner Prescribed.;
fifteen leachers to be selected in the inanrier prescribed;
the•Librarian of the University; and .
five persons of academic eminence to be co-dpted in the manner
prescribed.
(3) The term of office' of members other than a-officio members shall be
such as may be prescribed.- •
18. (1) The'Finance Committee shall consist of-
the Vice-Chancellor who shall be the Chairperson;
the Secretary to the State ' Government in
Welfare & Waqf Department.
the Secretary to The State Government in
Department;
the Registrar;
(b) the Controller of Examinations;
(f). one person, not being a member of the Executive Council or tile
Acidehic COuncil or a paSon in the service of the University or an •
Institute or of a constituent college, or a member of the Managing
Conimitted of any affiliated or associated college, or a person in the
service of Such college, to be elected by the Executive Council;-'and
the Finance Officer who shall also be the 'Secretary of 'the
Conunittee.
(2) A member referred to in clause (b) or clause (c) of sub-section (I ).!nay,
inatead of attending any meeting of the Finance • Committee himself,
depute an officer not below the rank of a Joint. Secretary to the State
Government arid- an officer so deputed shall also have the right to vote.
.(3) The Pinance.Co'mmipee, shall advise the ExecutiVc Council on matters
relating. to the administration of property and hinds of the University. It
.Shall, having regard to the income and resourees of the University' , fix
'Mins • for the toful recurring and non,curring-eipenditurd for the
ensuing financial year and may, for any SPecial reasons, revise during the
financial year the limits of expenditure so fixed and the limits so fixed
shall be binding on the Executive Council.
The Finance Committee shall have such .other powers and duties as may
be conferred or imposed on it by this Act or the Statutes.
Unless a proposal hailing 'financial implication has-been retommended
by the Finance Committee, the Executive Council shall • not take a
decision -thereon, and if the Executive Council disagrees with the
&commendations of the Finance Committee, it shall refer. MeiCtriposal
back to-the Finance ComnThitteet with reasons for the disagreement and if.
the Minority
the Finance
(g)
1032 RPH SaNidhaika Data I

' w ’ (iii) all Heads of Departments of the University;
‘4 (iv)- all Professors of the University who are not Heads of Departments;
”(v) the Principals of constituent colleges and the Directorsvof Institutes;
t ,> (vi) two Professors: from each constituent college, if any by ‘rotatiOn’in
; E; 1 ' order of seniority to be determined 1n the manner prescribed;
(vii) three Principals of afi‘ hated or associated colleges to be selected
by rotation in the manner prescribed; 1
(viii) fifteen. teachers to be selected in the manner prescribed;
j” . (ix) the Librarian of the University; and
_ . (x) five persons of academic eminence to be co- opted in the manner
3 prescribed.
‘ (3) The term of office' of members other than ex-afl‘ C10 members shall be
such as may be prescribed
The Finance: 18. ( l) The Finance Committee shall consist of-
Committcc ' ~ "
- (a) the Vice- Chancellor who shall be the Chairperson;
(b) the Secretary to the State Government in the Minority
Welfare & Waqf Department.
(c) the Secretary to .the State Government in the Finance
Department; '
(d) the Registrar;
i ' _ . If (e) the Controllerof Examinations;
(O‘one person, not being a member of the Executive Council or the
'Acade'riiic council or a person in the service of the University or an ‘
_ Institute or of a constituent college, or a member of the Managing
Vt Committee of any affiliated or associated college, or a person in the
service of Such college, to be elected by the Executive Council; 'and
(g) the Finance Officer who shall also be the Secretary of the
1 . Comniitiee. .
V (2) A member refemed to in clause (b) or clause (c) of sub- section (I) may
_ instead of attending any meeting of the Finance Committee himself,
, . 1 deptite an officer not below the rank of a Joint. Secretary to the State
a. 1 Goverrunent 'and an officer so deputed shall also have the right to vote.
~(3) The Finance Committee, shall advise the Executive Council on matters
relating to the administration of property and funds of the University. It
. shall having regard to the mcome and resources of the University, fix
limits for the total récumng and non ycumng expenditure for the
ensuing financial year and may, for any special reasons revise during the
financial year the limits of expenditure so fixed and the limits so fixed
shall be binding on the Executive Council.
\
(4) The Finance Committee shall have such other powers and duties as may
be conferred or imposed on it by this Act or the Statutes.
(5) Unless a proposal having ‘financial implication has.been recommended
by the Finance Committee: the Executive Council shall‘not take a
decision thereon and if the Executive Council disagrees with the
r’eeommendutions of the Finance Committee it shall refer the pioposul
back to the Finance Committee with reasons for the disagreement and ii
the Executive Council again disagrees with the recommendation of the
Finance Committee the matter shall be referred to the Chancellor whose
decision thereon shall be final.
The University shall have such Faculties as may be prescribed
Each Faculty shall comprise such departments of teaching as may be
prescribed and each department shall have such subjects of study as may
be assigned to it by the Ordinances.
There shall be a Board of each Faculty, the constitution (including the
term of office of its members) and powers and duties of which shall be
such as may be prescribed.
There shall be a Dean of each Faculty who shall be chosen from amongst
the Professors by rotation in order of seniority and shall hold office for
three years.
The Dean shall be the Chairman of the Board of Faculty and be
responsible for -
the organization and conduct of the teaching and researoh work
of departments comprised in the Faculty; and
the due observance of the Statues. Ordinances and Regulations
relating to the Faculty.
In each Department of teaching in the University, there shall be a Head.
of the.Department whose appointment shall be regulated by Statues.
The Head of Department shall be responsible to the Dean for the
organization of teaching in the department and have such other powers
and duties as may be provided in the Ordinances.
There shall be constituted in accordance with the provisions of the
Ordinances, Boards of Studies in respect of different subjects of ,
study and more than one subject may be assigned to one Board of •
Studies.
There shall be an Admissions Committee of the University, the
•
,
constitution of which shall be such as may be laid down in the ,
'
Ordinances.
(2) ffhe. Admissions Committee shall have the power to appoirit such number
of sub-committees as it thinIci fit.
(3) Subject to the superintendence of the Academic Council, the Admissions
Committee shall lay down the Principles or, !barns governing the policy
of admission not Carious courSes of studies in the University and may
also nominate a person or a sub-committee as, the admitting authority in
respect of any course of study in an Institute or a constituent college'
maintained by the University.
(4) No student admitted to any college in contravention of the provisions of
this section shall. be permitted to lake up any examination conducted.bY
the University, and the Vice-Chancellor shall have the power to cancel
any admission made in such contravention.
,• The Faculties 19. (I)
11
'
;
;j.
The AdmissiOns. 20. (1)
Committee
the
the 21.
(1) There' shall be an Examination Committee in the University,
constitution of which shall be such as may be laid down in
Ordinances.
(2) The Examination Committee shall, supervise generally all examinations
of the University, including moderation and tabulation, and perform t11
following other functions, namely - •
The Examinations
Committee
1032 FtPH Sa.Vidhaika_Data 1

Jt‘
Tlic Faculties
The Admissions.
Committee
"me Examinations
Committee
1032 RPH Sa.Vidhaika_Datal . g .
v\t\ r1~<\1ui\n-ht. ”01,.“ .. . i.., -...
the Executive Council again disagrees with the recommendation of the‘
Finance Committee the matter shall be referred to the Chancellor Whose. ‘i
decision thereon shall be final. Hg.
19. (l) The University shall have such Faculties as may be prescribed
(2) Each Faculty shall comprise such departments of teaching as may be ‘i
‘ prescribed and each department shall have such subjects of study as may
be assigned to it by the Ordinances. 1
(3) There shall be a Board of each Faculty, the constitution (including the
term of office of its members) and powers and duties of which shall be if i
such as may be prescribed. ‘
(4) There shall be a Dean of each Faculty who shall be chosen from amongst -,'
the Professors by rotation in order of seniority and shall hold office for ,
three years.
(5) The Dean shall be the Chairman of the Board of Faculty and he ~
responsible for — .
(a) the organization and conduct of the teaching and research work .
i of departments comprised in the Faculty ; and '
(b) the due observance of the Statues. Ordinances and Regulations
relating to the Faculty ‘
(6) in each Department ofteaching in the University, there shall be al-Iead' t
of therDcpartment whose appointment shall be regulated by Statues. '
(7) The Head of Department shall be responsible to the Dean for the
organization of teaching in the department and have such other powers
\ and duties as may be provided in the Ordinances. '
(8) There shall be constituted in accordance with the provisions of that
.A\ Ordinances, Boards of Studies in respect of different subjects of
study and more than one subject may be assigned to one Board of-
Studies. ,. . . ,_
20. (1) There shall be an Admissions Committee of the University, the
constitution’ of which shall be such as may be laid down in the 5’
Ordinances. _ ..
(2) The Admissions Committee shall have the power to appoint such number ‘
of sub-committees as it thinks fit.
(3) Subject to the superintendenee of the Academic Council, the Admissions
Committee shall lay down the Principles or, loams governing the policy
of admission not various courses of studies in the University and may
also nominate a person or a subcommittee as the admitting authonty in I
i respect of any course of study in an Institute or a constituent college‘ i‘
maintained by the Uriiversity.
(4) No student admitted to any college' 1n contravention of the provisions of
this section shall be permitted to lake up any examination conducted by
the University, and the Vice- Chancellor shall have the power to cancel
any admission made in such contravention.
2]. (1)_ There" shall be an Examination Committee in the University-
constitution of which shall be such as may be laid down in the‘
Ordinances.
(2) The Examination Committee shall supervise generally all examinations i
of the University, including moderation and tabulation and perform ‘11
following other functions, namely -. 1
{ia'
' rev-t . ..«*
Others Authorities
Appointment of
Teachers
'irN Lti affiltiRul 'Md. 28 M-701. 2009 33
(a) to appoint examiners and moderators and, if necessary, to
remove them;
.(b) to review from time to time . the results of University
examinations and submission of reports thereon to the
Academic Council :
to make recommendations to the Academic Council for the
improvement of the examination system ;
to scrutinize the list of examiners proposed by the Board of
Studies, finalise the same and declare the result of the
examination of the University.
The Examinations Committee may appoint such . number of
subcommittees as it thinks fit, and in particular may delegate to any
one .or more persons or sub-committees the power to deal with and
decide cases relating to the use of unfair means by the examinees.
Notwithstanding anything contained in any other provision of this Act,
it shall be lawful for an Examinations Committee or, as the case may
be, for. a sub-committee or any person to whom the Examinations
Committee has delegated its power in this behalf under sub-section
(1), to debar an examinee from future examinations: of the
University. if in its or his opinion, such examinee is guilty of using •
unfair means at any such examination.
The constitution powers and duties of other authorities of the University shall .
be such as May be prescribed.
CHAPTER-V
APPOINTMENT AND CONDITIONS'OF SERVICE OF TEACHERS AND OTHER
EMPLOYEES OF THE UNIVERSITY
The appointment of the teachers and other employees of the University and the
terms and conditions of service shall be such as may be prescribed.
CHAPTER-VI
AFFILIATION
'Affiliation of Colleges
24. (I) This section shall apply to the colleges.
The Executive Council may, with the preVious sanction of the
, Chancellor, admit any college which fulfils such conditions of
affiliations, as may be prescribed to the privileges of affiliation or
enlarge the privileges of any college already affiliated or withdraw .
or curtail any-such privilege.
'It shall be lawful for a college to make arrangement with any other
college situated in the same local area, or with the University, for
co-operation in the work of teaching or research.
Excepts as provided by this Act, the management Of a c011egb shall
be free to manage 'and control the affairs of the college and be
responsible for its maintenande and up keep, and its Principal shall
be responsible for the discipline of its students and for the
superintendence and control over its staff.
(51 Every College shall furnish such reports, returns and other particulars
as the Executive Council or the Vice Chancellor may call for.
(C) The Executive Council shall cause every college to be inspected from
time to time at intervals not exceeding five years by one or more persons
authorised by it in that behalf, and a report of the inspection shall be
1032 RPH Sa.Vidhailta_Data I

__ _ __ . - am new mam nae, 28 mail. 2009 33
a - ‘/____—__—~___.__—__
‘(a) to appoint examiners and moderators and, if necessary, to
. “i remove them;
i lb) to review from time to time . the results of University
examinations and submission of reports thereon to the
Academic Council 1
_-, (c) to make recommendations to the Academic Council for the
I . 1 - improvement ofthe examination system ;
(d) to scrutinize the list of examiners proposed by the Board of,
,. A“ 1 Studies, finalise the same and declare the result of the
=§ i . " , . examination of the University .
(3) The Examinations Committee may appoint such , number of
. _ .. subcommittees as it thinks fit. and in particular may delegate to any
« j | one -or more persons or subcommittees the power to deal with and
i decide cases relating to the use ofunfair means by the examinees.
(4) Notwithstanding anything contained in any other provision of this Act.
. ‘ E . ‘ it shall be lawful for an Examinations Committee or, as the case may'
t , be, for. a sub-committee or any person to whom the Examinations
“ Committee has delegated its power in this behalf under sub-section
; . . (3) to debar an examinee from future examinations: of the
i i . University if 1n its or his opinion, such examince is guilty of using
ll. . unfair means at any such examination
a. - Others Auihmilics 22. The constitution powers and duties of other authorities of the University shall ,
be such as may be prescribed
7 -, ’ . CHAPTER-V
APPOINTMENT AND CONDITIONS'OF SERVICE OF TEACHERS AND OTHER
....;~;:
23”} ENIPLOYEES OF THE UNIVERSITY
g V‘ . Appoinlmcm 01‘ 23. The appointment of the teachers and other employees of the University and the
_‘ '7’ ; , Tmhm ' terrns and conditions of service shall be such as may be prescribed.
E in ' ' _ l, . ~ CHAPTER v1
_ AF F {LIA I' ION
Afl‘llialion OTCOHCSCS 24. (1) This section shall apply to the colleges
i (2) The Executive Council may, with the previous sanction of the
i ' ,Chaneellor. admit any college which fulfils such conditions of
affiliations as may be prescribed to the privileges of affiliation or
enlarge the privileges of any college already affiliated or Withdraw _
or curtail any such privilege
(3) “It shall be lawful for acollege to make arrangement with any other
. . ' college situated in the same local area, or with the University, for
co-operation in the work of teaching or research.
‘ - ('4) Excepts as provided by this Act, the management of a college shall
be free to manage and control the affairs of the college and be
responsible for its maintenance and up keep. and its Principal shall
be responsible for the discipline of its students and for the
superintendenee and control over its staff.
(51 i i Every College shall fiimish such reports returns and other paniculars
. -‘ . as the Executive Council or the Vice Chancellor may call for
1y . I - 3(6‘) The Executive Council shall cause every college to be inspected from
' ' time to time at intervals not exceeding five years by one or more persons
authorised by it in that behalf, and a report of the inspection shall be
III
Disqualification for
Membership of
Management
Inspection and Inquiry
made to the Executive Council.
The Executive Council may direct a college so inspected to take such
action as may appear to it to be necessary within such periods as may be
specified.
The privileges of affiliation of a college which fails to comply with any
direction of the Executive Council under sub-section (7) or to fulfill, the
conditions of affiliation may. after obtaining a report from the
Management of the college and with the previous sanction of the
Chancellor. be withdrawn or curtailed by the Executive Council in
accordance with the provisions of the Regulations.
Notwithstanding anything contained in sub-sections (2) and (8) if the
Management of any college has failed to fulfil the conditions of
affiliation, the Chancellor may after obtaining a report from the
Management and the, Vice-Chancellor, withdraw or curtail the
privileges of affiliation
A person shall be disqualified for being chosen as, and for being a member of -
the Management of a college (other than a college) maintained exclusively by
the Slate Government or by local authority), if he or his relative accepts any
remuneration for any Work in or for such college or any contract for the
supply of goods to, or for the ex -cution of and work for such college.
(!) The State Government shall have the right to cause an inspection to be
made by such person as it may direct, of any college, including its
buildings laboratories and equipments thereof and also of the
examination, teaching and other work conducted or done by it, or cause
an inquiry to he made in respect of any matter connected with the
administration, and finances of such college.
Where the State Government decides to cause an inspection or inquiry to
be made under sub-section (1). it shall inform the Management of the
collage and a representative appointed by the Management and where'
the Management fails to appoint a representative, the Principle of the
college may be present at such inspection or inquiry and shall have the
right to be heard on behalf of the Management .but no legal practitioner
shall appear, plead or act on behalf of the college at such inspection or
inquiry.
The person or persons appointed to inspect or inquiry under sub-section
(1) shall have all the powers of a civil court while trying a suit under the
Code of the Civil Procedure. 190S for the purpose of taking evidence on
oath and of enforcing the attendance of witnesses and 'compelling
production of documents and material objects. and shall be deemed to
be. a Civil Court within the meaning of sections 345 and 346 of the code
of criminal procedure 1973 and an}' proceeding before him or them
shall be deemed to be judicial proceedings within the meaning of
section 193 and 228 of the ii...ian Penal Code.
(4). The State Government may communicate to the Management of the
college, the result of such inspection or inquiry :Intl ma% issue direction
as to the action lo be taken and the Management Thrill fortwith comply
with :arch direction.
(5) The State Government shall inform the Vice-Chancellor about the
communication made by it to the Management under subsection (4)
and the Vice-Chancellor shall communicate to the Executive Council tel
1032 RPH Sa Vidhaika_Data I

made to the Executive Council.
1 ; (7) The Executive Council ntay direct a college so inspected to take such
action as may appear to it to be necessary within such periods as may be
specified.
direction ofthe Executive Council under sub-section (7) or to fulfill. the d. ‘
. conditions of affiliation may. after obtaining a report from the I
' Management of the college and with the previous sanction of the '-,
l '- (8) The privileges of affiliation ofa college which fails to comply with any
I
r
q ,5 Chancellor. be withdrawn or curtailed by the Executive Council in 1' ‘3'
accordance with the provisions ofthc Regulations. 1 ‘3,
(9) Notwithstanding anything contained in subsections (2) and (8) if the 2; I
Management of any college has failed to fulfil the conditions of I)
affiliation, the Chancellor may after obtaining a rcpon from the .3 "
Management and the, Vice-Chancellor. withdraw or curtail the
privileges of affiliation
Disqunlificfllion f0" 25. A person shall be disqualified for being chosen as, and for being a member of - ,"
h. L m::fi::::t°r the Management ofa college (other than a college) maintained exclusively by i
‘r‘ the Slate Government or by local authority), ifhe or his relative accepts any 9 ’
remuneration for atty Work in or for such college or any contract for the ;
supply ofgoods to, or for the. ex ’cution of and work for such college.
lnSPW‘ionfind Inquiry 26. (l) The State Govemntcnt sha‘ai have the right to cause an inspection to be
made'by such person as it may direct, of any college, including its
buildings laboratories and equipments thereof and also of the
examination, teaching and other work conducted or done by it, or cause
an inquiry to be made in reSpect of any matter connected with the
administration, and finances of such college.
(2) Where the State Govemmcnt decides to cause an inspection or inquiry to , i 9
be made under sub-section (1). it shall inform the Management of the i .
collage and a representative appointed by the Management and where' ‘
the Management fails to appoint a representative, the Principle of the
college may be present at such inspection or inquiry and shall have the
right to be heard on behalf of the Manag'emcntlbut no legal practitioner
shall appear. plead or act on behalf of the college at such inspection or
inquiry. ‘
(3) The person or persons appointed to inspect or inquiry under sub-section i l ;
(1) shall have all the powers ofa civil coun while trying a suit under the
Code ofthe Civil Procedure. 1908 for the purpose oftaking evidence on
oath and of enforcing the attendance of witnesses and compelling
production of documents and material objects, and shall be deemed to
it , bea Civil Court within the meaning of sections 345 and 346 ofthc code
'- ' ' of criminal procedure 1973 and an)‘ proceeding before him or them
i ’ i . shall be deemed to be judicial proceedings within the meaning of
section 193 and 228 of the ii...ian Penal Code. '\
(4). The State Govemment may communicate to the Management of the
college, the result of such inspection or inquiry and mm issue direction
as to the action 10 be taken and the Management shall {outwith comply
. ' . With such direction.
I . .
, (5) The State Government shall tnfomt the Vice-Chancellor about the . . i
3 i 1 communication made by it to the Management under subsection (4)
. ' and the ViceCh'an'cellor shall communicate to the Executive Council .
|032 KPH Sn,VidIIaika_Data l
Dar on cibiri:r.; orany
donation etc. for
admission to a college
•• • • • .441 'I• cuv, . .5)
Government may offer upon the action to be taken thereon.
the views, of the State Government with such advice as the State
The Vice-Chancellor shall then within such time as the State
Government may fix, submit to a .report of the action taken or
proposed to be taken by (the Executive Council.
If the University authorites do not, within a reasonable time, take
action to the, satisfaction of the State Government, the State
Government may, after considering an explanation which 'the
University authorities may furnish, issue such directions as it may
think fit, and the University authorities shall be bound to comply with
such directions.
The State Government may at any time, call for any information from
the Management or Principal of college in connection with such
inspection, or inquiry.
27. No person connected with the Management of a college and no principal or
other teacher or employee thereof shall directly or indirectly take or receive or
cause 10 be taken or received any contribution, donation fees or any other
payment of any sort, either in cash or in kind, except the fees at the rates laid
down in the RcRolations from or on behalf of any pupil as a condition for
granting him admission to or permitting him after such admission to continue
in such college.
CHAPTER-VII.
Stmuics how made
Statutes and Ordinances
28. (1) The First Statutes of the University shall be made by the State
Government by notification.
(2) The Executive Council may, from time to time, make new or additional
Statutes or may amend or repeal the statutes referred to in sub-section
(0:
Provided that the Executive Council shall not, make, amend •
or repeal any statutes affecting the status, power or constitution of any
authority of the University until such authority. has been given a .
reasonable opportunity to express its opinion in: writing on the
proposed changes and any opinion so expressed has been conaidered
by the Executive Council.
(1) Notwithstanding anything contained in, the foregoing sub-sections, the
State Government may in order to implement any dedision taken by it
in the interest of learning, teaching or research on the basis of any
suggestion or recommendation of the University Grants Commission .
or the State or National .Education Policy require the Executive
Council to make new or additional statutes of amend .or repeal the
statutes referred to M sub-section (1) or sub-section (2) within a, ,
specified, time and if the Executive Council fails, to comply With such
requirement the Stale Government may make new or additional statues
amend or repeal the statutes referred to in sub-section (1) or sub
section (2).
(4) Subject to the other provisions of this Act the status may provide for
any matters relatini to the University and shall in particular, provide .
for
(a) the appointment, powers and duties of the officers .of the
University;
O321tp Sa.Vidhaika_Data I

. ...e, 5.“ www, LUV) .5)
the views, of the State Government with such advice as the State
Government may offer upon the action to be taken thereon.
5 . .3. , (6) The Vice—Chancellor shall then within such time as the State
it ‘ . Government may fix, submit to a report of the action taken or
I'd-i : ‘. ‘ . _ proposed to be taken by (the Executive Council.
1 , b . .
i i‘ (7) If the University authorites do not, within a reasonable time, take
action to the. satisfaction of the State Government, the State
. . Govemment may. after considering an explanation which 'the
- f i ; University authorities may furnish, issue such directions as it may
, think fit. and the University authorities shall be bound to comply with
i ' ' such directions. ' '
i ‘ (8) The State Government may at any time, call for any information from
the Management or Principal of college in connection with such
inspection- or inquiry.
‘ V main" vim-“aw; vl'any 27. No person connected with the Management ofa college and no principal or
"“"a‘m" ”‘c' f” other teacher or employee thereofshall directly or indirectly take or receive or
“Fmi-“ionmacuncge cause 10 be taken or received any contribution, donation fees or any other
payment of any sort, either in cash or in kind, except the fees at the rates laid
a: 3 down in the Regulations from or on behalf of any pupil as a condition for
' * ‘ ' - granting him aduussien to or permitting him after such admission to continue
1‘ ‘ in such college. i
“x' CHAPTER-VII .
K.
_ ‘f'
Statutes and Ordinances ..
Slatuifihowtnfldf 28. (l) The. First Statutes of the University shall be made by the State J
i I H ' Govcmment by notification.
‘ 1 (2) The Executive Council may, from time to time. make new or additional
. '9’ ' ‘ Statutes or may amend or repeal the statutes referred to in sub-section
‘. ‘ ' (I): ' .
‘ Provided that the Executive Council shall not, make, amend
or repeal any statutes affecting the status, power or constitution of any
authority of the University until such authority-hasbeen given a
reasonable opportunity to express its opinion in" writing on the
proposed changes_and any opinion so expressed has been considered
by the Executive Council. _ ,
, (3) Notwithstanding anything contained in, the foregoing sub¥sections, the
». State Govemment may in order to implement any decision taken by it
. , . in the interest of learning. teaching or research on the basis of any
suggestion or recommendation of the University Grants Comrriission
or the State or National .Education Policy require the Executive
Council to make new or additional statutes or‘ ame‘nd-or repeal the >
t - statutes referred to in sub-section (1) or sub-section (2) within a "
I“ ‘ ‘ » . specified. time and if the Executive Council fails, to comply with such‘
-. _ requirement the Stale Government may make new or additional statues
I ' ' amend or repeal the statutes referred to in sub-section (1) or sub
section (2). . -..
(4) Subject to the .other provisions of this Act the status may provide for
any matters relating to the University and shali in particular, provide .
i i for _' . ..
(a) the appointment. powers and duties of the officers .of th
gt . University ; .~ "
.
”323m Sa.Vidhaika_Datul
Power to make
Ordinances
'it AtiT 31311k/Rvi quit, 28 WT. 2009
the constitution of Pension or Provident Fund and
establishment of an insurance scheme for the benefit or
officers and other employees of the University;
the conferment of honorary degrees ;
the withdrawi of degrees and other academic distinctions;
the conditions under which colleges may be admitted to privilei
of affiliation by the University and the conditions under Which
any such privilege may be withdrawn;
the degrees and other academic distinctions to be awarded by the
University, the qualifications for the same and the amounts to
taken relating to the granting and obtaining of the: same:
the fees to be chargcu for courses of the study in the Universit
and for admission to the examination, degrees and other acadcm
distinctions of the University ;
the conditions of the award of fellowships, scholarship
studentships, medals and prizes;
the conduct of examinations including terms of office and mem
of appointment and duties of examining bodies, examiners
moderators ;
the power to remove officers (excluding Chancellor) an
employees of the University and their emoluments and terms an
conditions of service;
.(k) all other matters which by this Act are to be or may be provid
for by the Regulations.
29. Subject to the provisions of this Act and the Statutes, the Ordinance shall be mad
by Executive Council which may provide for all or any the following mat
namely
(0
(0
(a) the admission of students to the University and their enrolment
such;
(b) the courses of study to be laid down for all degrees, diplomas
certificates of the University;
•
(c) the medium of instruction and examination.:
. (d) the award of degrees, diplomas, certificates and other acadenua
. 11
distinctions, the qualifications for the same and the means to I ba,
taken relating to the granting and obtaining of the same ; 4
(e) the fees to be charged for courses of study in the University an
for admission to the examinations, degrees, diplomas
certificates of the University;
(0 the conditions for the award •of fellowships, scholarsIn
studentships, medals and prizes;
the conduct of examinations, including the term of office
manner of appointment and the duties of examining b
examiners and moderators ;
the conditions of residence of the students of the University ;
the special arrangements, if any, Which may be-made fo
residence, discipline and teaching of women students and
1032 RPH Sa.Vidhaika_Data 1

\
u “WWT 36 am new W m , 28 wet). 2009
l , . (b) the constitution of Pension or Provident Fund and “i
, i
. . " , establishment of an insurance scheme for the benefit of Hi i
. - , , ,t.
l‘» , officers and other employees ofthe Universny ; ' .
‘ t
(c) the cont‘ennem of honorary degrees ;
(d) the withdrawi oi'dcgrecs and other academic distinctions; T
; , (e) the conditions under which colleges may be admitted to privileé“
of affiliation by the University and the conditions under Which i
any such privilege may be withdrawn;
(f) the degrees and other academic distinctions to be awarded by.th
University, the qualifications for the same and the amounts to ,, i
taken relating to the granting and obtaining ofthe: same; , i,
(g) the fees to be chargcu for courses of the study in the Universn
and for admission to the examination, degrees and other acadcnir ‘
distinctions of the University ; I i
(h) the conditions of the award of fellowships, scholarships
studentships, medals and prizes;
I
of appointment and duties of examining bodies, examiners am,
|
(i) the conduct of examinations including terms of office and manner 1
moderators ;
:9. 1r: A
' . . (j) the power to remove officers (excluding Chancellor) ani‘
employees of the University and their emoluments and terms an
conditions ofservice;
,(k) all other matters which by this Act are to be or may be provr .
for by the Regulations. ' ‘
PM?” make 29. Subject to the provisions ofthis Act and the Statutes, the Ordinance shall be made
051mm“ by Executive Council which may provide for all or any the following matt
namely :-
I
(a) the admission of students to the University and their enrolment =
such ; i
i (b) the co‘urses of study to be laid down for all degrees, diplomas 311'
certificates ofthe University ;
(c) the medium ofinstruction and examination:
' (d) the award of degrees, diplomas, certificates and other academic ;
distinctions, the qualifications for the same and the means to '
taken relating to the granting and obtaining ofthc same ; 0
(e) the fees to be charged for courses of stody in the Universitytin
\ f for admission to the examinations, degrees, diplomas
i cenificates of the University; ' '
(f) the conditions for the award -of fellowships; scholarshJ'
studentships, medals and prizes; '
(g) the conduct oftexaminations. including the term of '0",
- . , n.
manner of appointment and the duties of examining 17“ I
examiners and moderators ; , .
(h) the conditions of residence of the students of the .Universl'EY. I
(i) the special arrangements. if any, which may be~rnad€ for
. .
residence, discipline and teaching of women students “Pd ‘1’ r-
$1 ; ‘ _ ' i l032 RPH Sa.Vidhaika_DaIal . _,
.l ‘
prescribing of special courses -of studies for them within the
University;
the appointment and emoluments of employees other than those
for whom provision has been made in the Statutes ;
the establishment of Centers of Studies. Boards of Studies, Inter-
disciplinary Studies, Special Centers, Epccialized Laboratories
and other Committees;
(I) the manner of co-operation and collaboration With other
Universities and authorities including learned bodies OT
associations ;
L
7. Annual Report
Accounts and Audit
the creation, composition and functions of any other body which
is Considered necessary for improving-the academic life of the
University;•
•
the remuneration to 'be paid to the examiners, moderators,
invigilators and tabulators: •
such other terms and conditions of service of teachers and other
academic staff as are not prescribed by the Statutes.;
CHAPTER-VIII -
Annual Reports and Accounts
. 30. (1.) The .Annual Report of the University shill be prepared under the
direction of the Executive Council whidh shall include, among other
matters, the steps taken by the University towards the fulfillment of its
objectives.
The annual report soprepared shall be submitted to the Chancellor on
or before su'ch date as may be prescribed.
A copy of annual report, prepared under sub-section (1) shall also be •
submitted lo the State Government.
31. (1) The annual accounts and balance sheet of the University shall be
prepared under the direction of the Executive Council-and shall, once
at least every year, and at intervals of not more than fifteen months, bc
audited by the Director", Coca! Fund Accounts, Uttar Pradesh or by
such person Or persons as the State Government may authorise in this
behalf.
(2) A copy of the annual accounts and the balance sheet together with the
audit report thereon Shall be submitted to the state Government along
with the observation, if any of the executive council before the thirtieth •
of September's every year.
Any observation made by the State .Govemment on the annual
accounts shall be brought to the notice of the Executive Council 'and
the views of the Executive Council, if any, on such observations shall
be submitted, to the State Government.
32. (I) Whenever any complaint is received by the State Government
regarding loss, waste or misapplication of any money or property of
the University or the State Government on its own thinks fit, it may
direct for special audit of the University being done by the. Director,
Local Fund Accounts, -Uttar Pradesh or by any officer subordinate to
him.
On receiving special audit report, the State Government shall issue a
notice to the officer of the University on account of whose, negligence
•
Sa.Vidlunka Data I

w m War we, 28 watt. 2009 37
H
prescribing of special courses -of studies for them within the
3 University; 5
(j) the appointment and emoluments of employees other than those
M‘ . t _ ‘ . for whom provision has been made in the Statutes ;
(k) the establishment of Centers of Studies. Boards of Studies, lnter~
disciplinary Studies, Special Centers, Specialized Laboratories
and other Committees ;
-‘c ‘ i ' (l) the manner of co-operation and collaboration 'with other
',L 'Universities and authorities ‘ including learned bodies or
3 3,: ‘ associations;
1“
r
(m) the creation, composition and functions of any iother body which
isconsidered necessary for improving-the academic‘ life of the '
University; ‘
(n) the'remuneration to 'be paid to the examiners, moderators,
invigilators and tabulators: ’ ‘
*r" . (0) such other terms and conditions of service of teachers and other
' academic staff as are not prescribed by the Statutes;
,, é ’ y _ CHAPTER-Vill'
‘ . _ I Annual Reports and Accounts
*' MHUBIRCW" - 30. (1.) ' The Annual Report of the University shall be prepared under the
J ' direction of the Executive Council which shall include among other
' matters, the steps taken by the University towards the fulfillment of its
objectives. ‘~ . .
,3 . (2) The annual report ‘50 prepared shall be submitted to the Chancellor on.
' or before su‘ch date as may be prescribed.
' (3) A copy of annual report, prepared under sub—section (1) shall also be
submitted lo the State Government
Amunmr‘d And“ ' 31. (l) The annual accounts and balance sheet of. the University shall be
prepared under the direction of the Executive Council-and shall. once
, ' at least every year, and at intervals of not more than fifteen months, be
audited by the Director", Eocal Fund Accounts, Uttar Pradesh or by
such person or persons as the State Government may authorise in this
, behalf.
(2) A copy of the annual accounts and the balance sheet together with the
audit report thereon shall be submitted to the state Government along
with the observation if any of the executive council before the thirtieth -
of September‘ 5 every year.’
‘ - ‘ (3) Any observation made by the State Government on the annual
accounts shall be brought to the notice of the Executive Council and
v ’ the views of the Executive Council, if any, on such observations shall
' be submitted, to the State Government
1
32. (1) Whenever any complaint is received by the State ’Govennnent 4
' regarding less, waste or misapplication of any money or property of
the University or the State Government on its own thinks (it, it may
direct for special audit of the; University being done by the DireCtor,
Local Fund AccountspUttar Pradesh or by any officer subordinate to
him. . i
(2) 0n receiving special audit report, the State Government shall issue. a
notice to the officer of the University on account of whose. negligence
‘dhliiktLDatal ' 4' I '1 ' .
.1! mums“ «"0" it“?
38 Tra7T 3WR-1179( 'lulc, 28 1:67-441, 2009
or misconduct, the loss, waste or misapplication referred to in sub-
section (1), has occurred, calling upon him to explain his action within•
the time fixed by the State Government in this behalf.
If the State Government is of the opinion that the officer should be heial
responsible for paying the surcharge: determined by .the stat
Government, the surcharges shall be recovered as arrears or in such
other manner as may be directed by the State Government.
CHAPTER-IX
Miscellaneous
Except as expressly provided by this act, or the Regulations;
officers of the University and members of authorities of the Univei-sity
shall so far as may be; be chosen by methods other than election.
Where a provision is made in this Act or the Statutes for an'y
appointment by rotation or according to seniority or other qualifications
the manner of rotation and determination of seniority and other
qualifications shall be such as may be prescribed.
Any casual vacancy among the members, other than ex-officio
members^of any authority'or body of the University shall be filled in the
same manner in which the member whose vacancy is to be filled up was
chtoen, and the person filling the vacancy shall be a member of such
authority or body for the residue of the term for which the person whose
place he fills would have been a member.
A person who is a member of an authority of the University as'e
representativ. e of. another body whether of the University or outside,
shall retain his on such authority for so long as he continues to be the
representative of such body.
36. (I) No act or proceeding, of any authority or body or committee of the
University shall be invalid merely by reason of :-
any vacancy or defect in the constitution thereof. .or.
some person having taken part in the proceedings who was. not
entitled to do soor
. (c) any defect in the election, nomination or appointment of a person
actitig as member thereof, or
(d) any irregularity in the procedure not affecting the merits of the case;
36. The Executive Council may be a two-third majority of the members present and
voting, remove any person from membership of any authority or other body 91
(3)
Manner of appointment
of officers and
members of authorities
(1.)
(2)
Filling of causal
vacancies'
Proceeding not to be
invalidated by
vacancy. etc.
Removal from
membership of the
.4.. University
Reference to the
Chancellor
the University upon the ground that such person has been convicted of,an,
offence which, in the opinion-of the Executive Council, is an offence involving,'
moral turpitude or upon the-ground that he has been guilty of scandalous,
conduct or had behaved in a manner unbecoming of a member of the University!
and may upon the same grounds withdraw from any person any degree :or
certificate conferred or granted by.the University.
37. If any question arises whether any person has been duly elected or appointedfl
iany questions as to the validity of a regulation) is in conformity with this Actor
.
and
is entitled to be. member of any authority or other body of the Universityp
whether any decision of any authority or the officer of the University (incluchng
Regulations made thereunder the matted shall be referred to the Chancellor
the decision of the Chancellor [heron shall be final:
Proviiled that no reference under this section shall be made :-
1032 RPM Sa.Vidhaika_Data 1

i
l .
,_ ii;-
.:i
38
Manner ofnppointlncnl 33_
ol'olliccrs and
members of authorities
Filling ofcnusal 34. '
vacancies
Proceeding not to be 35.
invalidated by
vacancy. etc.
Removal from 36'
membership oftlte
"x. University
\
Reference to the 37‘
Chancellor
1032 KPH Sa.Vidhaika_Data I
am new W m, 28m, 2009
or misconduct, the loss, waste or misapplication referred to in Sub.
section (I), has occurred, calling upon him to explain his action Wilhin J t-
the time fixed by the State Govemment in this behalf. L,
(3) Ifthe State Government is ofthe opinion that the officer should be held
responsible for paying the surcharge: determined by .thc Stat ,
Government, the surcharges shall be recovered as arrears or in Such A
other manner as may be directed by the State Government.
CHAPTER-IX .11»
Miscellaneous ‘
Except as expressly provided by this act or the Regulatiom
officers of the University and members of authorities of thc Univeisity ‘
shall so far as may be; be chosen by methods other than election
(2) Where a provision is made in this Act or the Statutes for an’
appointment by rotation or according to seniority or other qualification
the manner of rotation and determination of seniority and other,
qualifications shall be such as may be prescribed. ’ ,-
(1) Any casual vacancy among the members, other than ex—offieio'. i
members/‘of any authority'or body of the University shall be filled in the
same manner in which the member whose vacancy is to be filled up was_
chosen. and the person filling the vacancy shall be a member of such
authority or body for the residue of the term for which the person whose
place he fills would have been a member. "’-
(2) A person _who is a member of an authority of the University as‘
representative of. another body whether of the University or outside‘.
shall retain his on such authority for so long as he continues to both:
representative of such body. 3
(1) No act or proceeding, of any authority or body or committee of the
University shall be invalid merely by reason of :-
(a) any vacancy or defect 1n the constitution thereof. .or
(b) some person having taken pan in the proceedings who was no
entitled to do so. or
.(c) any defect in the election, nomination or appointment of a perso'
acting as member thereof, or
(d) any irregularity in the procedure not affecting the merits of the case‘
'I he Executive Council may be a two- third majority of the members present an
voting, remove any person from membership of any authority or other body of.
(the University upon the ground that such person has been convicted of an
offence which in the opinion of the Executive Council is an offence invol
moral turpitude or upon the- ground that he has been guilty of scandalous
conduct or had behaved 1n a manner unbecoming of a member of the Univcn l'
and may upon the same grounds withdraw from any person any degree '0r
certificate conferred or granted by the University . .
If any question arises whether any person has been duly elected or appointed”-
is entitled to be. member of any authority or other body of the UniversilYfl
whether any decision of any authority or the officer or the University (incllJd 5
any questions as to the validity ofa regulation) is in conformity with this AC“
Regulations made thereunder the matter shall be referred to the Cliancellor and I“
the decision of the Chancellor theron shall be final:
Provided that no reference under this section shall be made :- . i
Bar of suit
Mode of proof of
University records
Power to
remove difficulties
3RTMTPT vl , 28 th-7411). 2009 . 39
more than three months after the date when the question could have been
raised for the first time.
by any person other than an authority or officer of the university or a
person aggrieved.-
No suit or other legal proceeding shall lie against the State
Government or the University or any officer, authority or body thereof in
respect of anything done or purported or intended to be done in pursuance of
the Act or Statutes made thereunder.
(1)
A copy of any receipt, application, notice, order, proceedings or a
resolution of any authority or committee of the University or other
documents in possessions of the University or any entry in any register
duly maintained by the University if certified by the Registrar shall be
received as prima facie- evidence of such receipt, application, notice,
order proceedings, resolution or a document or the existence of entry in
the register and shall be admitted as evidence of the matters and .
transactions therein recorded where the original thereof would if
produced have been admissible in evidence.
(2) No officer or servant of the University shall in any proceeding to which
the University is nOt a party be required to produce any document
register or other record of the University the contents of which can be
proved under sub-section .(1) by a certified copy, or to appear as a
witness to prove the matters and transactions recorded therein unless by
order of the court made for special cause.
40. (1) The State Government may for the pulpose of remoying any difficulty
by notified order direct that the provision of this Act shall during such
period as may be specified in the order have effect subject lo such
adaptations whether by way of modification, addition or omission as it
may deem to be nedessary or expedient :
Provided that no such order shall be made after two years
from the commencement of this Act.
Every order' made under sub-section (I) shall be laid before both Houses
of the Stale Legislature
No order under sub- section (1) shall be called in question in any court
on the ground that no .difficulty as is referred to in sub-section (1)
existed-or required to be removed.
I.
OBJECTS AND REASONS
Urdu language is also spoken as mother tongue by a section of the Society.in Uttar Pradesh. The
Urdu language is 'required to be developed in such a Manner that any person of the Society may continue his
study to the higher stage of learning in Urdu literature including Arabi and Pharasi languages. There is no
University in the State wherein higher study in Urdu, Arabi and Pharasi languages and research cold be
facilitated to the persons who are interested pursuing higher study in Urdu, Arabi'lnd Pharasi languages. It
has, therefore, been decided to established a University at Lucknow in the State of Uttar Pradesh bY the name
-of Arabi and Pharati University'to provide advance Knowledge and wisdom' and understanding by teaching
and research in Urdu, Arabi and Pharasi languages to the scholars.
The Uttar Pradesh Arabi'Pharasi University Bill, 2009 is introduced accordingly.
By order,
P.V.KUSHWAHA
Sachiv.
t07310Z10410-70410 1032 ,<Rd4si(ft0)-2009—(2233)-597 Tfedilt (WI:card-2./ a /371tFik.e) I
tOkre010410—V0110 187 RiTo fam-41-2009—(2234)-850 WthZfi (0m1e.,t/er/3111:5342) I
032 RPH Sa.Vidhaika_Dats I

wfinamwm. nth-mt, 2009 . . 39
(a) more than three months after the date when the question could have been g
raised for the first time . ‘ ' |
I V" (b) by any person other than'an authority or officer of the University or a
person aggrieved- .- '
Bnrufsuil 38. No suit or other legal proceeding shall lie against ,the State
Government or the University or any officer, authority or body thereof in
,E‘ respect of anything donelor purported or intended to be done in pursuance of
the Act or Statutes made thereunder.
Modwfvmofcf 39. (l) A copy of any receipt, application, notice, order, proceedings or a
UniVC’S‘WwW'dS . resolution of any authority 'or committee of the University or other
documents in possessions of the University or any entry in any register
duly maintained by the' University if certified by the Registrar shall be
received as printa faeieevidencc of such receipt, application. notice,
order proceedings, resolution or a document or the existence of entry in
e _: the register and shall be admitted as evidence of the matters and _
I transactions therein recorded where the original thereof would if “
produced have been admissible in evidence.
(2) No officer or servant of the University shall in any proceeding to which
' the University is not a party he required to produce any document
register or other record of the University the contents of which can be
proved under sub-section (1) by a certified copy, or to appear as a
witness to prove the matters‘and transactions recorded therein unless by
‘ order of the court made for special cause.
3. ‘ “WHO 40. (l) The State Government may for the pur'pOse of removing any difficulty
" remove difficulties by notified order direct that the provision of this Act shall during such
it, ' period as may be specified in the order have efl‘ect subject to such
' adaptations whether by way of modification, addition or omission as'it
may deem to be nec’essary or expedient :
Provided that no such order shall be made after two years
from the commencement of this Act. '
(2) Every order made under sub-section (1) shall be laid before both Houses
of the Stale Legislature '
(3) No order under sub- section (1) shall be called in question in any court
on the ground that no.d_ifficulty- as is referred to in sub-section (1)
existed or required to be removed. "
. . . . ’
OBJECTS AND REASONS
Urdu language isvalso spoken as mother tongue by a section of the‘ ’societyXin Uttar Pradcsh. The
- Urdu language is ‘required to be developed in such a manner that any person of the Society may continue his ,
Study to the higher stage of learning in Urdu literature including Arabi and Pharasi languages, There is no
University in the State wherein higher study in Urdu, Arabi and Pharasi languages and research could be
faCilitated to the persons who are interested pursuing higher study in Urdu, Arabi‘iind Pharasi languages. ‘lt
,has. therefore, been decided to established a University at Lucknow inthe State of Uttar Pradcsh by the name
t . iOf A'rabi and Pharasi ‘Unive‘rsity‘to provide advance Knowledge and wisdom and understanding by teaching
and research in Urdu, Arabi and Pharasi languages to the scholars. ‘
The Uttar Pradcsh Arabi’l’harasi University Bill, 2009’is introduced accordingly. .
By order, ,
P.V. KUSI—lWAl-IA
Sac/riv.
_ ; IfI‘JV’ttolzprlto—worm 1032 W(l%o)—2009—(2233)—597 new W/a/airween
y‘fil’Wthotfio—eomo 187 We lam-200942230450 wfitm' (E11213? /'€t / straw—fie)!
”‘03: KPH Sa.Vidltaika_D:tttt l - . t