Uttar Pradesh act 12 of 2009 : The UTTAR PRADESH ARABI PHARSI UNIVERSITY ACT, 2009

Department
  • Department of Higher Education
Enforcement Date

23 Oct 2019

0.4,Tizgri-79 #'RPR 91-43—R3foRriioto/kWio-

5cc1,0/ kT9o1n 0-91 /2008-10

the te cp-41s1ie4

kirif TibT Tff( tibitzt titcm< ZRT Talibff

317iTairiuT tiPDitt (w)

(‘311' wa-zr aarrizim)

Yii)ciff, 28 ItroVa, 2009

lb-TFp 9, 1930 -Vr6 wa‘

.i-cpr situ tvorw ffitiRit 3iTir4-1

ti,e.Rft 493/79-m-1-09-1M9-2009 c1sPIth, 28 157-01, 2009

zar-iF9T fa

giti Th7 TT31.71-4q 200 31t1)7 AILI 171 ilt-Ca aCCI'i . 3R41 1-Mt ffralicitt M-cf- , 2009 tR 1iiCi, 27 1:677€1, 2009 .4 3Ft:A 31-41.9 4 3113 .4-6- wav 34fOrktITI

TI-C411 12 WI 2009 t WI A -il-thilITRuT '09T2.1 Tfi 3aRriT giO Ir41:4Td• Dim •ificfi I

ITtir 317-41 177# RZciDtiiciLf a, 2009

(\i'M 3TaT 3.13tr*Pi 1sJ1 12 TFI 2009)

1 1/4;1\1rJ1srk1ftw9 iluScf giO 'eta pil

3T-41 3fri ih7T-4) 414T34 A ftE-44alv argtur4 t ,iccNw-a-ir 3Rif1 t5141

14scatzeta 7P-4441- M ftrrq zict4ti cm4 att7 wif4 31TErfkra trt th4-41 ml um-an th-RA

3114MTPT RTM iluNlva è*11C0 74 Af"IfR4cr S rota uliciFt:—

3TUTTEI—co

9r9 1— ifg 31W1z111 3-M7 3R-411 MIT41 feTafeVicitf 3alfral1. 2009

pRui • • th*r

(2) wizr 0,11 1 -44 Tiny tkok A 3TRII,T4•11 gii

frizra w3i

image0.tif

111111111 11121L121131191m1192111m1111gu1121£fm112$11§11111(z) 11111111£ 1&1; 1111111111 6002 MW ngg} 11112111111191111511111 11111113119 9.111(1) -1 1111:1111}; M1111 111—11111: ‘3%WWWWQ§EW$MM 11111111119 1&1wmmgmgwfiwmwflmwwmwgmmmngmm 11111911111191111121111aa mw$m11£1e1uem1a1g111191m111111n11191¢119§11 [laiagmmfimhmgmmmgl (soozLaZLMWRgtmaa) soozl'mgmmwwmm @1211ngmefiwwwmgmgmozmu111,111 unugwmgumgwwmghfimgeeooz wammeooz 'mgmmgmg 11111111111111.11111111111111111211002113111911.mg111122111. KW EEI— . sooz 11,111.11. 92 2125111 ‘ 6002-6(5Q)L-60—L-Q1-6L / 26v 1125111 1—111111219 112mg; 1111111 11111 1111 . 1112111 3111 0961 '6 131321.111 . 5002 11111411 83 111112111 $111512 (1111111112 111—11 1.111 " (93) 111151 '1—11111. 11111111111311 10211111119 11151131 1112 1132111 111161111 11111 31 MM 21 21111 25. 111115111 . ot—eooz / 16-011mm) #9122 -°1£h/ 0111011110111—1211: 1:113:31 0

2- TiT 3TffiTh iWri ffi7F?i7i A 317421T 31q(hT 7 14-

-reVI TIR40.'" 'VITT" 3T13 Tfttfq" m ITTT:14 fasra-are:p4 Th7111.: %AI cftt, 34211 3113 iPJ trittR 31 5;

-3i-4-4 wartaat m.4 urerzi il311 3i3eir 31 ,--41 $-34 31fOrtitrq

(Srearaia44i½ qft ½ 37133T3 1-4mfatrwzi vi}

ticisc ;

..-fwg-e[ TItatfiffT c57 11343%11 t1 TET1 fesqffivr-44 gI31 Afremr ITTLT

-Tat Th7 TTT171 ThVeT7TT-631 37TTRE t; ,fa

faraftalettf Thf tii,11-74T71- (TT TIM OVA !all) ThT 711044

MVT31 tit) 404 0 t iI 101-4117131 14731 1410TI w7171.6j

AiTr 51 all-3 IZTRIA ITa9 -emu 3FT 3TTE7-05 Pl&Tur aiti32.7 -0; '

.[7-0WIT-67.1ci -1311,11-0171" -‘61 cm.94 b51,1 nofil r ck-7

Th-413:1 *clq '34 -5 -A f4scifav1ett4 brr3t 11110Tt

ART -4k TTT TE44 1 T6Tici TITiTtTIFT iI 1.31TETRin

TRTRIUZTTitlftrall*Esvil fka433 icl

(2) "Itta- icr uktid trftMtrrA iV1 ff -a t1;

th911 tio4, tit:Tivr TT 1.4eth 7.41Tthuc4i1 i3174-41 A

urperzi 134 Traft-uTati 7119 t;

"Vit13.34,VI tFPW tt5T ofcgai 1JW fa911 3-7-rrei ti

(io) -713fitzur. -atairtzt" 3117 -ffen/P1's I5T Th7f7T: 1:*frazirazi

zi trfazTA, 31afft7f 3117 W4t17 t;

"31t71TTTh." TTTT4 34 741 IdJUIvi 1

717P-T17 TT Wit Lica), 1-11.1, in TIT-1M TitIlf401(14

lbTfaTaTat"' ThT TrecRi uT31 3 3Tal itufga 313-.11 tb43311

farofrarmi 34 Si

3Tarrzr-r

l qIciieiq

fastfroranml 3- (1) C1STi 'actN cci3 rthr af41 51 thwfkrralf, -4r4

winvn

nn ffinnn 74 \TVftreCelregr Wrni Vet VII 01 I

(2) ittard71 -) RP! ci tITTT

favenizith - 1.4c1143nati ttii \aqaul tpl,U V34 ar41 cei mm11 wqi zRIET3I

T-tr4vn Rt 31134T417 UPI 3. 71 STT1 srd 7.17NT WC2,1 chi-fl '61711

DsaDirern oil did 5-faVe4t/Tail wf 31-1 tizT 14,723m f471T 31111 ti1W-T1 r8e 541

3fiR tit] Z 91 %--t T33UHF tl Wit TTT a TO 9t1 31/1311 7411177 ft5 fa”faCTIF9

iu far4,14 ite-Tur Ingisnit A zratrifta 333:szli aiRm 33.5I siNt

3TeT

trv1 9T34 awr gzufavicizi 39-3ftd raiR0

312TVE 9171ftel t 3171 1tP4 0111 T1 91511Th 111 M ft tWIqv4-0

741 3-1*141

FawAtnan YlizaTtli 6- faraViall 5fi P fl1Rd youtri wned-04 "6171, 3TeT:-

Teri 4) ca (1) Rtir m`t ncrai k f; thwftar-gzi wrn- A fteivr 4

1032 RPli Sa.Vidhaika_pata 1

'1.

image1.tif

31:5" -1 WK. 1 - ‘ [IRWIN 2_ ’1 ' 1‘ 1 .I‘ l .' , ’ i 3 . a : 1 E I. I',. 15: l: I vi“ . 1‘ V )1: z 5 ' § 1 'i5 : .' .‘ I P i 2' i .1 1_[ ,«r '1 Q 1 i :I' 1; i. _E‘- -j , finafim a’fl ' 3- I“ warm nun film 95" ' ' mammal! a?» 4- i! . 3132311 '1' Raummau {rm d'fl 5_ i “' 3m u‘u 23 RN 3m 11- 1 , [375951312 3% mfi‘fi'm' 5.. ' I i ' nan. win: if ‘ 1032 RPM Su,Vidl1aika_VDaxa l 331 3113131111 1‘1' m am f3; 31751111 31712113131313 =1 3r— , (1)'f'3u1qfiqa“¥n'1r'afir‘cb1d 11mm" an mat! magma “Eh mimfimqfhaWHwQWrzfufiwafi‘b‘ ' 1' (2) wmwrfaamu' wwfiflmwai! sfigaaxffifimfl 5' \ MT In Wall a‘a qfifimtfi a‘> 313w? [azafaarau m ":3,- (3) 'wg'fi WW" 2131 armi 33%) man 3) ‘3 Uh 3321121211313: gm 111-11311 W 31-, (4)1th W aficni 13371133113111 :3 mm 3 3,- E > F (5) Warm 251 '51?! 133131" (In 1131133416111) 251 amnf 2615113, 1) WW 35" W 3613 3 3 Uh Wu Em HERE: ur ’"Wfii’ cnra 3‘1 31?? RM? mm 31211 W 31311375 [312M 3%) amen 1:); 3 (s) f'asafh‘wa'u an "1313113131" 2:71 maid m Ham 3 (3:1 W373 (E i F ,1 g: fiamafififis‘cfiréfi‘é ufiffisafiamumlmmmvm»? 311121331211 Wmmgfiwfimaummamm m-j‘ Wwwzlmmu$maTfiflmvafisw433 (7) ”W33" 251311111 qfifimfi 21111313331 3 1, -' (a) Mmmfimmwmmzfiwwfi ”'umtzl m" WW WW :3 war—1 3 3 1 ‘ (9) “(13113371 mam" an arm} 1326192113103} {326) W11??? 2‘; 3 (1o)'ufifim1","“ala113w 333‘ ‘flfiml' 371(an Wm: msafaum fivqfifizm awfiwsfivffimfiffi; (11) 'aawm" mamfiéfiwfiafi3’fiffisaffimzfim‘ Wmfifihm,mmmrfimfifimmf 31; (12) 'fififfima" 351 mad am 3 3 3129-1 32111331 3134) mm“: W 33 awn—3‘1 133313311811 . (1.)maw Wfififimuéfimfimflffiwmzx «B1171 finifisafimaufimlfimml a? WWWQHSHWWEWI 133:qu Em {13331 m7 213 3?; m1 321' 1mm 111m 21% {31W qa’sqzwrcmlamafi mwwmwm-Imaml fiwfiafim anm wa‘flWna’cfi fir-n'wfi mfimfi 3‘: RN 337“ Fob—fl 314 um 21% 131151) am 3 :13 331' wen Gnflvn fis (Mammal? ‘ mfififitmfilmmfimmfiamwfiamzsmufifi‘} Wflmfi? mamfiafiémfimfimauflWwM-L awwrfififimfifiwfiw‘flfiuflmaEWf'wuwfl 311131313313?th Wamafifimfimfififimfimmififi amia— Jr (1) tamaamwma 1314mm 31313131113} 13mm

frT ctlq1 chi-11 at 3171*IFT MT 3TMEgtt4 SREN

Thfirci Wciff-11 chi•il;

fth--41 Tea Elicit( Th4 i1lf441(11 1 111.4111 45i thiit1IthcbjWe.;71 atl-z toicgqi Tiwgwi 71-61t -ara111 mi 1117kt9 Vrivilnu

\i•ia qffilir Th4tur cM-11;

31-Taal, fttab9i314 MIT 37q4 tlf8 f&P.rtiz.-4ijft iPgr 7-0 vailt rf- 7 T 311-CrI•1 chiqf MI1

3TRT S Thlite-er rAt-ca 74 C114-17

ffirl-tA lI1yiei i fr ft-t tito 7Tui1ur-dti •tf

tic4,5 ii6iRviet4 aT2T4T 14)-{11 'R1311-thl 1113-AUTM.1 fOt t4Iqt4n i5T 3iz24Zr9 fi1flir -6);

(-€) f4raf&vicia kZI1 th44ffit5R-R4TI 31 Mftai TruRr-dT MP l, 14-ftflzilli MAI 3Tarate 14 Sft-a VM1 3Tth71 31--VETP1 cpid e4RIT Zn

(4) ft- 4 qjti -Rt, tifay-Auk-14 a)- Ole{ ft-4M cfr<c& ff1911 tfll 31U1119 1t241 g, tz q4 7m1 311t9 i0 un mar wrrasil

340-- Rm vtiq, curio &lath 11W1 gjv ff54 4-4 b4: IP"

(17) '-iRflwciThzu atuutvi 1 a40mtl vr-di * 31017f YU WWI 4 wr f1941 Tfail-9. -41 tiect) ZIT

Utrziwr Hs114.4ici.0 4 TIT 31'tf %Elul Ti-tarrs4ff 31Ezni45 4t arRi m-4401 t 3{zrar mn4 -cr6R z fto fa4Pr 3ti-R11 Tut ft4f* Thti altat 14, att- 34-d

4FI4M'i ru 3T6711-4-414 14 3Tfm-fOrr snil 3T019 trilt Wci 31aftf9" %-zil g; ITT

(3) 3fri 3I-g g 3tYR laftl?r-ifr4 -02.1f &alike &REM-RI-a Tal am114 crinvuicr vizil artzpa

%LIT g; TIT

kerff 3fri 3rg g 3417 Mi-b 1113144TP um

34Wite l't 34RaU rd-T 347T atemtf WET 31t2111;1

14,t4r t

7-4 urnyr41*.f7, 1T 3ff211FaVIN

31C2R/9 Th7R1i t , tItaitet 31Riffft chi•11 3fiR -\374-t, Parea-ara-4 c1 3qilI- P-4-r9 cmir;

t43f4zP4 4 3TRiaff ftf4 awc 3407T TI19-4 31Si 3TP-MI 3r-41 Rut ITT4-41 taf3itco1 cren9

4kalfatiql' a a iletara-n -a"; 13-1- i. 4 ibtair 311 wits441-ti ituat tzweii 4579!ii

aratfta Thl;

WTI Rxafacficiql TITRim-Tal4 tRtt MET (NI f'aq Tr-gm-Ri ITT W-6-titTT chilf flita-̀ 34itaiN-0 31dETIRd w4;

1332 RPII Su.Vidhaika_Dzui 1

image2.tif

311111113fi3131113131111m$f113ama131$131fiqf23fiq1n1 11111131331111331; '(2) @7111 Wmafimm 1111131113111111111111511 511111 mmmwml 11311311131111 an Twigsh 1111111111n 11311131111371fiu31311>131;_ (3) 311m,1%131111131131113131 1111311113113111211‘111'11111111131' (4) 111611111111131111311111111311111311111113 15111 11111 11331111111111, mmmmfimm3dmwm:— (a7)fi1fi=1fiwfiamfimfin11mw®um1m Wmfigfimmfiawm—mwwnmfium fimmmaanmfimfifin (15) W 11111111111311: 11‘ 11 11121111211111 3111 1111 1111111 mmwmfimmawfififimaw 311211111111311161‘81111111111311fi33131111r117111fi1u111; m (11) 1113511 111111111 311111113 13111131113111 3‘: e111 11’ '111 111131 I WWEW,MVWWMHWIB13111 vhfifihmfa§31fi33€1§3713fifim1m131121fi2fi 13193193311113 1131131111111'11‘1'3 mfif'asafiarau gmfifi‘fiafirfirfivrfifiqr (3)313Wammmé1fifiaffimmv13nfln‘ WfimmflmfimMmmma mWWfimmfimemfifiaM mmmfiawmwmwtfifimn 111111111 111Td1mf911111§13fi111111131fi151111<1111131811 3111 WWfimmwfififiammfinsflm‘MW Wmfimmfi;m (1) 11111111111-1131‘113111131111131111111113111211' WfimmfimmIWWQMW 11111181111 (11) 31131133131183113111111—171311111111111111 31911721111131Wa11111111311fi'161fi1111111331131wu1 1111111111 la (5)®W$.%3.Wufifimfimawfi1fifimma ‘- 113131311fi113111133f31m81JT118111131m1fi111msfi1w Mmfiwfimm; ' (6)1fifimfimfimfia11fiammfi111aefiwwwfihmmm 31111311132111me (7) 11111111113131fi1fi1fi€11ma2m381 Q11 1111111111 11:11 mmmfifimmfimmafimw 1121111111111 :1 fiafiammfifiafifi If , . (mammawmmm'mwmawwmm a 1‘ ammfimmmfififiafimmmfiafi; i 1032 RPH SlVidhaikItDEUi l

4 \i'VN TaT 3ffifsff79T I'4 d, 28 9ff7-4711, 2009

Fas-ofotir-T: aitiMmit

(9) Ycl SlIdtf 9N1 3Tea aTairq7-q -q't

IT-41 117 cziraoct fleavt

(io) 1§1,1f4-4-riz A ftazur a4*thc 3T21Trr4 ct it-ticir 'in; •

(11) a-dill ti4,gcn zn 41n-z4cn u1-4,01 .u

aTh

J 341444 cr,

tpia_TAzi tR12.41Z110 gRT ZIT 3F4:12.11 3TEFIT

V Thnt Tet tk;

(12). iaP1-4zi.il u2-z1 &Taft& 34ThiR tn,ccc1&iL aTtn5T-4-tzn

azisn3-qr-wzrf 1.11 g), fa--arPznji

-RIR-2m cm-n 317 ‘34 144I-f ctN,11-;

13/1 ir4gifit714TtP1,119N4 •t4R-P-id ivu ch I an-R•

farard-CTIFZI TR-P-T191 zfr ut.4, ZIT t14•Ei4 TIT *iwrk-r

Tisv -*f9 f4-qm 7-Pa-r-ft z th-gcn ;RN

till thcl-e att3-TRIMT mindr VtCI cfN-11 t 3101-(

f4zrd fd 1/441Q -

(is) it raitar-dzi, --ztztzR 241trz- t14-cl4 T isccf T Icth rtil

f4n-R1 7 zrztaszu-r uarr f4zOur at)- w9-14

3T-grriT9 MP/Ad CPdI 3 &lc?,

'al-47%ff ort4i;

(16)1011,6 1+4, ed-fi4T Tag wit 3T-1 31 -TWITh- ITO 71-a9- '01I

f41ZoL41 4N-11- ;

(17) .4gt m-rzl ctroi, tog - 07141 Tre4TIM 31-1Ten- /Fr

-0, 4 Sr .1cannt 31-1-273R M ff,f7 311)-1

z411ind4 31Rr4ft

3ilt4,Yr ut4:-

(). T-a-rRIzrr6' ;

(ir) aTf44q1 ;

zr- zr ;

(f.i)

- (13) t{1 az:r 31-PUMV ft g- RT 14Ze4-alc,10 --ct)

1"A ,itia

s- (1) 7111:11-F fSr5T .sa-dttrit tP ITs azt-T4 zrn

antinz

itrecarF7•1 M ;rum -ffazr TRH ThTTni -rqf E)A aN. 7)14 lrbr..

1-7TT 31t-4VF9‘t 311-R itrclinlicil-f

zo4-a ST-g1-9- cf,;:r SM)Th 43clifb-Lta- The)

31.92, 4

?rn,ntit9 tzn

-4:5rff zr! cr, "ar 6 faa-c911 4>) SRI

7,1;;t4.1t 1--# 77FM-it 3tfid, f.;-t4 ch,e1110 - 1TJf .971

Th-‘1

image3.tif

_. “Em vaE E: 259. .wufl .3555 E 5:er E EEW WW wfi FEE» mm pmfiflwwfl & 5% BEN wk mm firmfi . . , . 5% g: .% Em am gag HE E E E HE £5 E? 3. MA Erwlom EEK» .5 E; Egg] 5% w. EEE 2% E55 2% E E % FEE Awbwfifiwfigfifigfimgufigbagflwu 3% may E E Eu. Em @559 E am mmmwm EEEV 3 1m gig , £5 E E6 A _. .Eeswwwfiegefififiaufiggfig. A .. A. U 5% a. E E _ NEE 5% E w E E u E5 EE 3 u E E “£559,va , PM Atfiamufififiwgrfifiwfififigfiflfifi AwafigwmgfpfiiwgmwaEEEEE A EWHEEEFVEWW “E 5%. ”Q pm Em 5% 579 Em 3% mafia _s E fibgoEEQEwgwquEwflfifififi E? E. BEEEEw 55E. ‘wfimflfiflfis Ewfiflnwwfiggfimgégvfiggg “EEKEEWEWVEEfiE fiw%.EEEBEBEEE& %_E£EE%€E5FEMEAE Sm Erma Am 5 E5? E E EV EEEEE AEFE Ems an 3% 5 Egg E ”mfifigfifififi Eggggfigfiwa WEEEEWE gm 5% raga? ggEBEMwwambEfiflfisz LEwE.%r§§5E%¢wE€aEEBAE “Eggfifiéagfin gfiwggawfirglgagfizggg E 83 .E mm E E0 E E v

igge'

kirk 1.15YI ZijtjNNUI Te, 2 tr<cifl, LUU9 5

(4) ,wmfecrfa 0 4th 3P74 71%71:41 b Tfi 3TRIcktI 4Rf4-aai gni R4I ‘3•Tc4S) Nag SM9Thei ‘7iTg

9- (1) 910919 tbalaviciu an 31145lt tt9T 3t7 9./.1 • c•t3e1014t WT ZTf1tfW it 3) fkgayr %-ar wain frima>, 414 UCTZTRI (2) winch- 31-174? Trthu TIMM- gpo WiTt Th)-1) TIT.) I

3#111.9. T1" .ftf1-919%-9 99'14 tit 3T2na:-

(T) Tel ( rl. fMrat11-671, wrn tm Wrgail

91 TITATTg Tita-CITF-11 312491, 9I,Iffmr3 T1T 31910131 3)

3TreA49 tl) 14ain 41taa gkr War rin4r

(4(14R1 trarafti warftr own wer* wa 1-4

iTi-99. 9°1 1- 1331 3?I 01 3). Th-Ti ;

dWIcilC 31,4 -914.11c141 TIC°4 11111TRITTI% g 9PT-iTTM19.

TN) U11:49, 44 T37T9 -91141e114 5T-914.49 ref t 91 TOT 19; 3113'

(71) T,F4-4ci% gkr 4rafff-,Tz [Tr!, weer 1tAfitf art

41 ,i1;

4r-gl c4 Tatra R3rq45)

fai-q7i cM T1 &umi TOth t, 951 cri 1 1:419 311119-(9) 34014 31a-4 gkr V4419 34N-T-99 (TT V-Titi

0 99 11 9e40" affil10 tr,;(4 A .44-1kf@z m-44 i

3149T3T (7) 31EIFT 994a 31419ftf 9991 119 MITI * uf,

9),919 M TR A b44 RWr opTha aarrsiaa m-4 A 4,4

'1I Rrf Ø3413 W9 011 th. cipaITTit 919 31994 9114 3DR

N vita- le4 ‘111‘7) gia thfilifftz vti4. Af4fr?i • ce,c11 4ifa &TT A wrt `?171 arm aT14- A 3TRI 434

wf4uay t• 919 Mipt• clAth dr ..m;Raffi- tra uRia m-z4

.314,gctrf I gife T,F1-104f0 949 IfT19 ThV PE1 it111709

it aint1C41 A A •cra- -211io .v‘2.41 31R4 ffiil 4 , 3#419 f993-19 414-at cif'Pg 4-4

3444r4-m-rr \14<1gcr 9 ct)th 1 •

(4) ,rei T--,FrfOtrft 3:rf4 gHT Rrubiftst 14,4 wWrai .111

wf4yr aril-at e1-zin 71-FT wrzin 4ti

9419 t 31991 RN) 1 RY1 fL-1.) TR) are4riT4 A A iii Tairft4ai

&fro Neef Wrd-Cti 7 Li 3th .TaTittn 7) wayi

<..-a 34 Th7 U1r4991 99) thirtf9 ef WU 9) TO Afin uatuRT (3) 4r41 4 0 cR-c-7 0th 0 31991 1.113

TEMT) 1 '

if Aftrit zatirir (3) zu utrEair (4) 4 Thittz ftqft• .gaii-oaro

gio fa141& 3rat1 191 9P1 m IOTT9 t.) 344:4979

343TTTO t ZIT 311Th W.:641?Pira 3-nit TT re14)11-49 if..-1) 99 99 919

cricli 4 A f. 5-+11 kg, -ar 3TRUfi J51 ticf f41399. 'W4 KarA 41/2

zazjagr 4f. f thapa41--;1• firm A afWdo

a4%-i-al 4& Telt) Ptg9VI URI (3) $ 3p144-3I11

A fe4 Th-T 9111 IMF WI I

7iffilt icr44 TIT 47.1-Ent claci i 47ur aTearn7a thci

w441 (i--:-(44 tf 13W1 4 3MP1! R54

1032 RPH SiVidhaika_Data I

image4.tif

531 $5 a Emma 5 E1 E, 1," bag E é E15 aw Gr. 35% .315 Wm E Exam 5 mfi 5 GE» EPWSFPETFEEWF swig ”m 3 Em ab fib mama flaw. in my % EB "2% 113% wqu@ firefly. E m Eu» rm.“ 5%qu $Egfiagfimfiw§sfifiéfpfiw ngngEEggggsme SFErwwmfiWfiErggwflwswfififlEm Epflilwmrfig WEEmAvV EEWEE Engagfiw .mwigfifihmmwufivfifirwrfimbafifigg qggmmfiasfipafififieagwrfig Efiwegyfifiwgwfiwfigmes 5€§_HE:%€EE§:E. mwmgmwfisggafififisésfi fiégrfifiagghwaEQEugwaéwwE Efiwwfiflwuwgiwfls Ergggefigggwfiggfla §§.Egfififiwmgfigafi grgnrmmrfimmwugfifiugfiwflgfifimg wEEEgEEEeEEEwEB ngfi@»m¢B@5%rfiwfi®E.fiEuflfiafi gg‘gfiywaafifigfifiwpfiwfi gnawfizasfigggfifiéfifig Egggpwmfififiafisfimwwuwg gazhmmwiflgfiwafigflfiwurfizfiggg Eemwmangnvgfiaafiufiguwfifi 5&8 Bu EMF, fibflfl gflfir EM «a» £35 % Ewaw gag E .m. Ev WEE c E Eva E 5% aka EVE», w 5.9% Ear E E5 PK. ”Erma” $55.5 E E cm EH .3 wflflér E E E gaufiivfingWEWEEPWmfififlflg wart? Eggfi EEER EHEMEM E gWEEEcEwgfimg réwflwrvbfigszbfigfiefigfigv m.EE_PéEmEquEEE€rEg ”y EEWE 5 Egg 1535 NEE? NEW 5 Ema» Kama? Fab EBE Engage E warm mm. E 1535 .fim E FEE rm}? rpm? WépmfimerufifimmflrEfiEfiEng Erwtecpwfifiémwmawwmgarmsfifineg mm 1,12% E Ema @159 E E35 Erma EErfiEmu rfiEEEEMrEw—mfiu stageswmwwfiemsfiwgfififiéflfi {I'LJ . $3 53.5 3. EV: §ZJ$§ Eu: :5 3 1m 1% 3 ,

Ti 3M1}-TRui 1Iulu, 28 Th7qt, 2009 )2fifr l,,;r!

(7)

var -Tc-4 194 ff,rirr itffr* Tirgru 4

irg 141-5 'r4fbi zw wr 6cbCk •165T ITJ

M cclef 3.TTzzjfbj Tn iclit 1:1-qci Fitsf4Tr ffic 34-6

ir fair4- *Ha wi 'et sw-vr Met Zi;

(U) ctrIL1 3474 tR Weir ("') Thct Uft ati Thcl 3104 ITZft trq ZTRuT ch II;

(TI) 42,04 , ffi39-4 ItIcI 71 4 am/ wvr 9 4 *.r-r WIT aT-q-14 fR f9-gavr wr wcbt :

cr3crALIRE *14-6Avt 3tti 1-6--errarRvr

g crocit apt9r tm Tam Tr-EAT atY- 4etarc4th

clII-'fl 937 V ffi-4 ,414 q6 3199-r trq wur (N4 t

Miff WzYTIT I

(8) 3TR119119 3iFett 344r9 '46 q, tQHRI 4 wcrailtzri.

u•ar ,Aur ar--q4 7r4 v.11 gfr 1,,tr ‘9,4cok ,emikui ZIT itAq

afftsr gii i mftIM 31-0WFfta c0 I

(9) tc-P-Ira .<11/474 qYcIraelidtf 3TRIPZ19, 1973 Th1̀1 bINT (33) i3aR

Tredu -14,tft it(44-11 ZIT 9ftrzr ftRr wrzrk 1I 6cr,K 9tvrr :

EfT vier fist fazqi4lciZI 3T2NT fS-44 3r2-1-ar

ITElfdtitall Th7 eV 311241ITT 3T2NT 3TRIt4ia ctrItIra

f*trr .11?) 8- ‘3v4 \itr a f4f4 A ftprpr Tru 34441-m t

3TWEN ctr< •<64 Met aTITEM t41 3117 1axcI11VId4 7T 3r8qT9-,

ti *IT clq, S411 rvitf WRT- ria f4W 6)4 3tZT-419 4McIl '46 I eti

(io) fs4 tiftfterfaM A- ft-4* Rcirrh-r 51-) t 9r1 „ 1- uilzrcr) te44 p,criifvfZr cgclifWa. 111

t 3PT%iT tr-crait Tw uhir far3r4td

. ,•„ trq LR zko?r m-7 Tr44:-

(m) ciptifa Th-T le:St t 3 tcI'NAI

14q14 Thar *1411Rd a-T-T color Rqvr

uiiA arzrar \31101 Pqvr. Ortr Trntrur t. il e-tra

cgervacr gr4 ,r,rilata- iMT-vr wrq-41;

(u) ut5f qier4 Erg Rqvr viir) .ta waTTRT 0) i1/2

(5) it zmr-q-44it 31T117 if4}1T 1T .311ENT tf INT TIM—dr

et;

(9) 1*-4t & &gra ReTft

ctriALID WNW]. 341-9 cgclq TR TR

it-dt arf4ff itt1=4gf4fric Er-a-a 4-vmo-viri4 4-4,1

**1 vrm-R itt .Q4i Mr 4 ctrt 4-4-r-414

tef 31-Ttta Pim ara t Icrw -44 4,

S 9 tr

(i1) i5N cit fbi 31:1tTRT (i) ZIT 31:IZTRT (5) ZIT kiLltINI (i0) it31V ,

1 10 tt 5T itZhIR 9 fAr ff4

farcrithrazi '4t5--dii awal, croLD

m.49-r I

lift -43-arra itt 3Iti tida 171 3IWZFE

-,Fruffku 9-11 ctr<vir irr mitrikvr <rr<4 (12')

I032 RPH Sa.Vidhaika_atta I

image5.tif

~ Sdéxuémsvgdm :5— N8— EwEEE&BE?EE€E5m wEEEEwEwfigfifian m3 mung cVEEmfiéEmEEEEE . .Efifivmfifibflgpfiwflg EEfifiEEfiEEEwE ®E¢EEE£¢E%E BEEEEWrfiEEEEE E tfifiggmflwbwufi Efiwflflaggwfiwflflgwflgwgb @EBEEEEEEEEEE EwwwfiwfiEvagaflarggmflflEflec fimvEEwwwfiw «EEEEMWEEVEEEEVE EEEEEKwEEGNEEE .mEfifizmewafliflrwmfimfifibg AEEEEEEEHMEEEE nggggagmflfiflggg “Emwzmwmfigfiwflaaflrfigfgfiflfir gafifimva%m§§£fl§EmflRflEE@ JWEEEEEWWMEME gfigégficfigmfigfigfim sflémfiapmwfiwwgswfigwwgfig EEfimwfl @EEngwEEBEgEEEE mg Em EcfltEofi van 3%; E v: E Eat? EM figééfifiwfigeimg Hwfibfiggafiwfig géfififiwgmfifigfifiégmfi E ,. EEEEB .H.§%E%®%%EEKEE E mfirggfifififiéfi fgfigmcggwgmfisifi. E s _5%WEEEE§&MEEMW¢ #:EEEfiEaEEfiErEBE QOONEMNEEEE o

(s) altefrAPIZr ; atIv

V11X Slq.21 •31tIlb1IC 01 'WIC, 28 LYtc1.<1, 2009 7

3m4 4 f4fUu Trfdaal bT \v.! 17 r t Zr q !rt. q 3112.T1 Atha th fi Vita. MT 117 tH 77. '(641 1qflwqizx t m 3fit-dTh7 t, t+11 qr< triam 141 N31-qcr Trrrt, 3itt URI ttrI4(a t). 6CI tit t I

(13) 314LTIT (12) fkr& Th51 uiI1f4WITirq 6 t 4-#1 klit I 39EAM c.t) 7 ctrufWit a-u

al-fray &raw

(w) k, q2,(14 , td4 444 ‘Lrqici-r 4)- wzratuf ul,cr tthvUlt fa* Th-c

uquRi- (8) 31117 60qH an;

Tatlit tiq t 014 WI 1-11441“ 31-r-a-vr 4 f4f7ff-Z•an‘7 gpa fthqr warn I

io— faxqfdta Rco 3Titt-rt, cteific& aterr M-aw, TitTZTInt&i. 2ll SP4-af mei mlar 0.ft 1-#1 f9w1-13a

vui

311.7111—TR

efic14 t IlAchat

11— lqfweix et sultwill tit —

gerottii sta7cit um odd'

ft/dfatirell snitot

3T7I I:0744 giO 14( ftzl

qttrq Th-r *ma 12-0) (Dui afka 4 P,-IffIcr

(w) 42,5144, 31WeT 6 ;

(7)• fax4tuciq t .44141)e0 rr -42.41 lfh tisrilmq ' 3t!ral- Tim-maw I

(2) (,) lazqUatamq arrard uqtri-it 0) NO '4 Thitz- ft-41 ticoicutiief

Thi et. m ,341-014 ffi-4M-T fann- 4-41 faft9- -et ; • .

CO • . 'enctd I.161 SrW Tiql" Q4 11f? 1-44. Wa Mita Thcl 7T7 1

(3) T117 *.71T+741 gpir 79' ce414;Ril 4 3,1 -‘4 Tra fazufavicia.za TiTerr9. ill t'91't 1,iwar9. trr 14ach .4161141104 Zr FSTAThirica 1-wiravamq

312.171 um 17diff 6icf Zr 1.p.*:qtr 4 EFT *All 4 1IHif,cf 7 A

z9--4 taT 4 9- A (4). (w) qR141.4 tru tri-Thate Gh w4 cue? *Pico Tred- s-r

1032 KPH Sa.Vidhaika_Data I

image6.tif

... . H 1. ”EB. .. ..EEEEEEEEEEEE E .3. 5555555555 . fiwgwgwgawfigfifimfiggnfiflmfir ..EEg.EEE¥.E5.EEBE§E ...5555555555555555555555555555555 3 . EEEmeaEEEEE: . .EgEEEEEpEEEE.§ .. . .55E555555555555. ..figggfiggfifigwé Ewmc5jwvwm5CEEEE555EEg5 @ . EEEE .. .555555555555555555555555555 .5 . . .....Efi555EEE E 55555555555555. 3-5 9555.553 ..555555555555555555555EE55555 E . .. . . . 55... 555555. E . 5.55555 E 5,555.5 15555555 E. . .. 555555545 ...55 E 55555 E _ . IfiEEfiEfiEE I: . . .. . w EH 3 w n W_Bm_mwm_. KWIESE. 55 555555555555555555555E55555§ 55.555E§5§.5£EE55EEE£.$5 . . 55555555 . 55.5555555555555555555555 E . . "5555555555; 555 .55555555555555555555555 .EEE5E55E5555555.E55 E 555555555 ...5555555555553555555E55E5 5.5555555E555555555EE A3 _ BEEEmeS..EEmefiEEWMH EEEEEEMEEEEEE. 55555E555§55§E5§E 555555555555555555555 n 255 $39 xx .32: 5:229 5.5x :59

8 thi WaTT 3M1E1RuT 11 /44 , 28 Wft, 2009

id trfiiir-4 viraryri N•1-• m-tar

(v3r) cq_11 •TertifcrIttif t rna-r-14-fftz itzrr kin crie T6 •ar%

1•Z-Ri4 \it-4 %au, t in 4 416ccquf tri<19 r+-ITT

*tf I1E157 -F1T-f4-1& ft-711 71-u ai1Zt I 4 crili

tiff aiThi IT iir WM irr4c1R •A 1 4.11 cdzn Trro \Jr.! ;AN 1-taA

Tizrrzfrvr er zrr . sr

(5) •(-I ci•-0 ThT Th-17-1Th-re tfrr 1-41 fäultir Thu 14-4-azrr—d-zr liRftzrIn

arEarte,4

(6) alfaff, 717-1 qftzNe7 MAW: 3TFA-7. 31-74 ft;TR

t:1'1f1

(7) $. 3TrafifTT 31-744 31"-TL'iT 4 3a 1 -741. 41Tf 7 SiAA gcr. ttily

a.f4-6r oct, 464 trf3ER tt-Lf 7t/1 M-4'4o• tn 9TrI4rt!tt2.

7f7fTT ‘Ilet tit ft emocr, ti

cr,1:1 wro 4,14 trRtr-6- w4 3fR 4-9 ari-Ek

ca:Tel TT Nit1c11f TriAw-Ti -ft-rot:Old tf Ai 3721-c1T ‘3*.7 1'41-ATT1 f1i 16m

ftdc; •4034- 3r24--r lAta.410-14 011 71 370 cla:f c.M iifth

ft41 <bid tr ft,- ,1 coo) tt crq rf-a-Err rcfltrR

Er2-.(iy "4-T 69E1TC Met -e,rm ft.41 37E2717 gi3-r Tff w 't all

ra177.iferuc;t4 gifti-c4fir a Wit ilt&LTT TRW-4i ft-qi 77-eux0 7-f qi-7-f:

cr)7Til 3r2.4-q-r fth--+4 S4flThTur c•t•4 zrr fth-4 ffi-gru zrr "OThAT137.:11

3-TO‘fr carr art6-r zn -q7:07 irtIt ttarl 3rQ0

foratliciLf:" TrWIWT ft --41 Vat; øi4 triRsstritt

cr).4 dig, tift •

ttit810,(ur — • tr q-Nr k, 6h)qk 77 Aiwa 77141741 S, 1956

A137-6 A ITRIARA '1ai4i at *t1ct) 3ITht 1-10-11 (AT Alra) 4 ,1 174,

(71. (TR IrD) 4-0'mr 34)7 14E4, g-tt I

13— (1) f.tpiq1aEv11 tt ZT.cb.rd •14-t-rzr 61-t 3 A-1 3fMil

7 3qpr-11 7 31c5tT V, 37N71P.i1Rici7tafgri

3Ts

(cP) fqflE4Ie14 7f Wffi1 2H fARRA crt1 zrivr q<ii afi

Tr4AituT 'N.5-11; •

(t) C41 .4 zn tv-TM .Th7c 310*A

ct)'&11, -

( .1")• 61,11-11, RM1d 47e- fr 11T f4- 31-7 W,FIT;

(-cm) faitte Muiilt• •lb-4f4snertl urtitIchk 4 741 -47-F

triii9 cm9r;

(Irk° Th-T I3T ft-7 t11;

(A5:) Lfftf-AA:PA 7irr arwrte ar-IFF UN1PTh afftrun

vi••)riRcitri, 44,r) A2T1 WZTErrWIrk- cm•rr;

(end) -fcrRv.ricrEr 31-Rrtrft4'1, aTiZITTE UP-if aTR1cp4iR4t ThE

4).11 34h ‘31:t) Znk10L1f 72TT 3-9Thc1 Their -ZM1 Th1 inf

3tH Met 3R-Zi-lt Al ON (fa if[470-Af

LiciTql;

(31r6-) ITAai-77 Acal7e,Vit 7-CaTA t71-27I Th-Tqf

(8)

, 1032 R1'1-1 S dhai ,a_ Data I

wese

image7.tif

21212 112121 31211211221 2m , 28 222221, 2009 ‘ 1032 KPH Savidhaikq Dan: I (E!) mefififfifimfififimsfimwm'm m2fiefirf21mzfia‘fifing‘mgfimwm9ma: WfiWW1—99Emnfimfiflfifi2‘1wmf 2mw9fifimfi‘momfiqmmmm0fiamamu' 211211292131211'231311 W1WWW221121U92121199229W2§2992113 31221122112‘1’99923311 e51? 251 221921, 2512} 11922 £121 121nm? a1 21 W 31219 <11 91? 212221 ET‘TH 521319192121$912fimww2m923mfi2m$ '3‘1211g221‘1’raa Wfimwwdufiwfiwfimfiai9fimw199qfi WWWWTEWEWHBM mhmwfifiwldwmdmm‘wadmfisffifiwda‘iffik" 29222132125121W922921W2312m12212§99719¢1251w1 1912st5 11112219211 2112121 92292162222161 21513111192271 21512112 W321 @1211 mid (17131111124 «123129 ems 21139122112712 217211133: $122.11 321 31121121 2131 ZhTé 2121 9211 3122111121? @121 221 "211 21 3' 92192112121 3121 2121921 9211 11212.11 25‘ 21121221 21 1—217?! 27462112171 :11 mfimfi’rqawffififigfimmmmmfimfiammmamm mafia—cramméfi 312121 111erc2211€2gc2 (17 212292-21 27:12112391231 122219211221 217211612411 nmgafirfifi <12an 611192 217122111221me mefisfim ' , mm— s21211212,_211fiz’12”m1211wfi2fimfih31992m1956 m-efiqfifififififififiémmwffiwfitmufi)mmé (m29)2719a1,2?v§1(m29)2§1292212fi2113fi221fivfi,2fi%1 ‘ (1) WWWmfimeMWwW fiméfiakfififigqtmfifimfimwfifimg (21121) Wammfim 212n92127-2vn21192272r11 (2112) WW$W9WW$W212§12§9 1919131331211 22:11 21211 31:211231’1925 22121 22241,- (21121) 9229211811$319fifi211 Wwwmmafl mmmmfimfimmfimfi2mfafi‘1um9’t afi2fi$fl2fiefia1fiamfifififi9fiafimfifi M411, (31rd) 215121211 6171 11512“ 3112191211 11211211211112.1312 21121 1121a 2122-11;

treiftrazT M-Y tia.bErit zif mjcr M Iksituf44t wth crpfrir;

Ttieff9I. TiT4. Yelper In 614VIe111, tit14R1134 UPTT 191-4 M 3TRI fn 3:P419‘1 ThtEIPT mj ITV1P-T 3TTUf 31IP iftP1 t1T.

OTT% ftTUTh1 /4-1Ie11-I ti6;< M 31FMR muWATT trettl r

(t1k6) caPc11411e114 341211111M vtf, csTrirAlf '44 MIT 3171:1 MT1I.U1t-44 39;741 M 3171TUR IlikikUTTI warr arurratqh trn 3171111 ft-4e4Mcr MTF P-43 45 744;

(c'2) egeiLT M Rut Thik.ffit wtritti. cratqw uur 317z1 writr,b`lir m14-0(11141 MT TIV-41 31IP ThreftIRRctn.jj, 3TIR. 330 IT1tMR M aiftim-of Novi *it 4tu TriT&

(T.4)‹ ) itttra wog z.N .4 WIPTATT ct) (ç— g) iq1ic4Itq M c0111 .4),(4 ferrcr 311UPLIO warri, th-114,r

utzu TraN3fr 3TRI TITtlt (71-1-d-u)ftracfm retzr 3T1R ctrt-ff, 391I trfttathr *rt.

0,1111Nd. 3TIR fiTfff ct) TT;

fl 3Tfed.ZT11, 14RnITHI UP-TT 3TPITTtPTI reZqr4UW-111 Mil M-10 tre- w<reg. 3tr-6-ziwr trrotreric•ttr TFAITI Arl 71111 fattzti

aft R fAtiti3u 4,?•i1

,fl.ar ty(c.bH TV) if4.9.1 cin4 lac3., WRIM .faMPT, antri, UR UT 3TRTPTT ThPc4 criVie114 M ThR wPvc .MTT ROW .11RINLIT TE4749 M 31Tri 1 TfItTrif fthTTRI 1TP. "kt 31.-- ur *ft ath It-artr :out( \`Ntbii fisaftleiti ft:4R 44 tI61440 3FICH WM 04 mri .7rd -b-LT 3121-31. tiMTIP MI TIVT fMtl 31R1 U1f4U t1T-41 tR tI9 3t4R &Pi MI

..<1 \tt<ON Inkvf VT47 T%-t UT/1 311TIU TTECI. rth-PIT 1TiPfl 1 .11T.M TITURT 1Irt alibfkall ZIT Tfrettrii airn 3Ittflt711 IT 3171Z1 33irk'm & aft3.11 .R-TR.M.R 11,4111 4,1 M. RTUTET MTIT4 211. ffiPUlat-IleRf ITT fareaVIWT UN! taif-dcr fi911 Tip-TR 312TUT 1-4C0 9T61WaTFU 7r-e1 MRtit

(3T2Tar glow wr ftrater 41 -4 war tH01.1 gm \LINN! lir fe.4 -1)i

,t)I tztPLic,, Rxcrfatarctra 39-cr9 anTim 3117 gal TRMIT? 1151111 t Mt/UM-fir-MI ft4t 31tUTITM MT T4Nt tCQ11. 311M1411 1.4- W11 tift 3tit m-7 war& t tir alarm-4:5. 4 tirtviti Irrer trr fatPT itET M P.411/1-1 ZIT TA AMR M 31RI

Pirf A .flqh, 'Tem tg ER g3I 3TE2TILIM wr A tonw4 31-1-fiw arcr--4T 4IR-9 (EiriviTfOm-R) atiR uatwil

Gfrii iict 3t17 War ai 31111t MTTJUPIR 31-4.10 311e1 0-1111-1 aci4 Sztri 31M mt7 xtici) att ltfato ff.O• 3TPUTTU W.1

3TM tUlftP M FUT, LER ci44' m-3. twit : cr-9 tqi *--antrRiii arof4 31UTTEEM 1. Pc4itart111

TIM Mtg teT1T TIT! Tiff ?ITU I (134PH Sa.Vidhaika_Oatn I

image8.tif

n... .u .u-u. .avv‘l ma 23mm 3?: mm 111 11mm 2:} $3)va a) nah W; WT, m, “333“ III was mfiamfi, ma—erm, maranfi mmfiaémfimmwfifififimmmamrsfiv fires] éwr. fisafiamfimafi,wmuafiwmwiamfl$ W$Bfiamfiqfifiwfimwmfia§a§w fimfiamwafiamm; mam a} film. FWET. fizfim‘r’. W61. arm—4w am an: 1111‘. WW1: emf—WT as! W 3ft? filifiw arm, a??? BTW Wfimfimfigfimmmfimwfl' mammaEWaw'afififimfiam; Wam$wfimfia§fiwarqmwfiuflmiwfim mmmafivmmfifimwm; fiafiamuafisfivamm.ewfiufiammmafi Wefivfirfim; WNW, Wmmfisfla‘smw [asafilmau ‘mr mwaasfivwrmfimfiwwfimar-uwfifimfim fifiufiasfivfimfiaml wmfiq‘émfifimmmmmflfimfihm mmmmfim‘mafimfiwmwfim wwfimfimfimfiwéfifiww Wmmfimmwfifisafiumfifiqmfi mmmmafimfivfimfiawmumvafiw WWEWWWQWWLRIWWWWRm mavnl WWWWWWWRWWWWWWTE‘T mmmmfiwmffimmqfiflmfimwx Wmfiwmqfifmsfiafivmwma} Wfifiifimfiéwfiwfiaafimmfiwfimam fimmmmammrmfiyfimmmm m(mmumfié¥fiaz mmwmmwuur Wwfififififll mum,fiaafiamafimmafiqmwzma§ Wfimfimmmfififialfi affifiwfiqaswgffififimamwfififi€Wawuwm mmmfiémfifimnFEWTmmsfiwwfiaw mmfivfiu'mafififiamfimwmawumw fiwfiwfifimfizfimmfiwwwmamafivvfimx mmwmmfimmmafimfitfia‘gmfi Wfifiafigfimaflfimwafiwfimfimfimmmm mafiwfimfigfiwEFrmUfiWfiHmw—IWW mfifiafifmwafimzfimfiamafifiwfiumu m'crfis‘fimz’unfigiml

I 10

‘3 3RiTEITiur rFire.., 28 th-R441. 2009

(s) f474 time er Tte.479 312747 LF woltaree lIT *d arum e-rijwi 4811azfree fret.=1 41ein4 miterre4

37R1 474 at 814 tvo \LNORwr 3717t4l1 flWArift/1p

01 7:IMT4 AR*ft1tzr Wf A andl MP. 317T64 V:174 fttiv if414 gre Thlre 4,8 S 12111 elpicr 444 c0,111

War kW<S tecicg ewmi 4)-gl treirsf 177 fteR

old tre411q, 3fTWO zM ewe: 87-gera4 wer etrefluil afl1/84

Tite Ire wa 4 *4 m--Rfwef 4-61 crM1

item i171 Rickg Tinteb. ftR '171)

41 nIiteeft 1- a ao *IQ 3fi3 Mt MORA, Thlltaret Zll tAttgi 7 TRA 1I5Ri4 g41J till I

aid 7rffer4 .4Rfli,4I 3Tittl. ffloqii 37t117

Yci 87f0m-r4)flM1tii ar4r 170m-41 aitrar

3Tf4Th a74-41 014 srfae. 1:d.4

v-wrii1Wa 77#111

14— (1) TNT 71 itcMffZird 114i4-1 elk 31?-47 :-

47f —7T trte 115i-4

(WO QiI1MR ftalteet

(1) ørd 1713q4*

gm) ccr aarwrl

871—t

(41, ) 1W1 fttrere ?as-aft-am-8 mei wer irel-th . ift re

vre47 814 JIt ItTllif ZIT fariT TIM &Me) 311-441

\H<I-i4 tit

wf — 114. aeft ;Of*

z znet gie tilf44 14(.4, iroft-tirei4

ft,wrfare;

(a) fograwou S we* Er-cm et.878 twit .7teet 1:61

3itR 'ETN fkue i;r)413z4 7127r•gi•1f eaPRE ftnwr.

tri4 tfli In 4 f-78 urre Thlte Tee;

(tut) tT aits faTt-r 444-r. ki 14,ur Liso 041 fafgtf.

vga;

(ro) wi tir tit:wrd 48ift-txrdel vaitf tef trfaflf4;

Tam ZIThVjOH AtiA In fth-in till fa-Ito all \Alt

— Dk&rlv-r

(711) 7ite elic1W1 cn-g 9Thif4D, ar4f3e0 7.,Te fl ffitto Thor vII6, tit 4.4{.-4)--t:e 74S

14;ii taut) Thireaweig lIT f --41 -ewii

71i;IPP-1 4.) er:- 4 81'781 wig; irgigivteRii ij

(..?!H! 711 !;13M131 tit 481. 4 2447.0 via)

I 4,

3 4tt:

image9.tif

. iv u 'L, _10 m 4 14— ’53 RE‘H ‘;vl.\“hl:} :I'ku ‘-.:‘. , "m m srmmw "HIE: 28 WENT 2009 flammma‘wfiaxwucmmfiammafig” mm mom mf‘hanaua‘: mm: mm $Wmfilfi$ '” mmmafififimmmwmmfifimm ammmmammmfim. mmmmmawawrmfimmw amiqfiwa mafiafim, agaifiamaqammw aweumfimawmmaml Qmmuammmgmmmwmmm, memamafimfiafififléfim . mmnfifim‘rfimmg‘mamn mammmmfimflmmmmfv magaararmmmmmzm,mniagmfl ‘ m‘fififimvfihfil ' wfifimmfiwfifi,mfa2- ' awf—qas mm fiafifiufimmai’ffll mumzzfimw. mam ‘ arf—a’tsnafiawmw ; MWWfimafimfimmfia mam $Wfifi$m1fiwmfimwmfiz WW' mm, w—mmmsm mammammmfimwm WWWW,WW%WW€M ‘ 31TH,“ I mmmwmm$mm$fiumfifi.' amazwmfimflfifimfim 6% ma afi'cm'u; awf— WWW szaa m, mm 11 m mama 2‘:fo wmwfififi‘lafim WfiWWWy (mu m m": :n (Nahum In W “W” 1"“; I ~ 25*, m" n; 4 {’1 31am WEB; ’lb’WdU '— 1‘1“: m: 0.1m n Bram i131 inn fi 24:1?

FL

vrm 4 wr4Tilli ‘ri (brio

31M Thl 3alt4T9

Pam- glitim

‘scir AWE 3Ffilt/NuT , 28-K67411, 2009 11

wf- qt-4 ufrttm`• (qA) Ira* *tow ir ti1:CM 3-ff c,jq 11, yafavicri4 t 1401

zicrar trtterr :afw Trrtu ctp<4 ** traq. thrtfaiaraw ft-tt 1-ticto \i‘u q• %ell Luo,q0q Fi 31a107 *T61 "01

- vrw %art Hu•ser cree4f4 (Tv% METTI" TIRn t trictit, "I'"9-0 44-1 ‘irwi; gifl'f4)4I" v40; ; (oN0 ftwq AT* qjj 441-1.1, M-qwr 44-1 \i*I41 gki.14)4T 1/4114 I

(2) ‘34tiki 0) -4 qfofu stw, tlfq 1W-artr wf Trw5q1 ‘`) tritti1 "Oh Wf erTil 3th \it'd' Wf 5 Trwit 0741ZI" "cr- Wf 61,111 1 iT4T Sr" rtic1i6tH f40/1 *I, ti "4"-fi 3SFATE4 -0.4n/1 t 3417 .<6a wfter f;,--11i2stt ath c ç -

(T) fcifjiciq 0 afflict) tThill R.T4 tTS q 10—\11941 trg Ti et cori ortrif 3th faxgraciici4 72-T 127T 1'40:f1 fk; wtra tm;

(R3r) fcfcjq ml ono I-30d, i14t *al wq-et 14ffi11 WV. f4wi itt titpqm wif4u 4),211;

(q)

etru 41.? ifith-di 4# ?Wm A.RT-4.1 .* 1 /4 ftliz Wzi VIR WaT tT; 3t17

(Er) tik 31-4:1T-daii m 1:11F9' cmr-4 viu t0-414 cor<ii ‘.ir TIT qintuti 3121-41 TFIRtzlit 9N1.3114 unCi

(1) ,7111T 31f4bN 'w4tur gl-qr uTA 1=4-cm- yucl1 tath i;reif am" Rini 0 411-44) 3110171 4,6c04411 I

(2) ettm4R1, 014 011 0 4) wit TNT 31M"thiri crft "flt01. arR TRH wwit 43ef reit.s4i t 01 31 01

TRuLaw A fkftra aTurefurIT m-r ftstir arftrirq gaimqr

_17- (1) qui 4137-4" faY4fac4icri4 0 T.94 Ivr f=400 61,11 r 3th -431 rtea-441 uzir aTantsrl* .uwwyl* aTE117 -gq -

gxcifcqcia• FW) vq4 iã ftepq ftrat aiWffifi yet ctR-4 arifitifq old ci-tu; r(94 fq ‘3cvN4Tth 614l ailrt \itIct)i fkZITIT faflwirr .,b1111;

(&) ftruT ART-4.11 tuncr f4wil try, apWfu ft-mfZ41 "gI•RI "i4W11d" rteTT311 A Anictrd. raga 111 't"1, 4)0 tIftiq 0 .Ritrft.

(it) 31R4 !I1hqI .myr wd-ar ETht 71 \I Tiftwii gkt \itt trq arRARiu \in(

(2) ftfT 71444 Mir-irk2yd 4t4 6 , MTh. —

(7-0 optift, 3ft 3TaTET 6 I ,

Ttwrwure;

019) ffikrofdtmetu fWwilarzT; (ti k) threourFq Arii1 anwd ftflurrivaai 7 In;

(4111) ATVI4 Ti7-ew4 q'i fkkm-5;

IC32 R.91! S..

image10.tif

”55E ”n $5»? 5c. ENE ”m fiwfiafik. Bum E r 5255 E E0 6.5 PM % Ea ”SHEEN“ 65% ngflfifl “ESE w FE any “5% $36 cw Gamma Igfifigmflfigwgng _ _Egm§zggfifi _.EEE%UEE%EEEEE0EE . . ”sf; aampfigauEmggefifinyfiEE Em Egawwfi E «FE vb E E E g . ”cpfiufififlagwfiggg ycmahrrfiEESEEfiEfiEE EEEVfiE EEEEwaaEERa lymgéwgwgggg WrwfiEEgfimfiEfiggfia _E&Efis%agggzfisgagfimw ”Ewafifiwgwgwggfigwgwfi .Egfimggfifigfigfiwmflafigg ESE Egaésfiégfisfiéwfipfig EEEEMEEKEfiEWEEEE _E%Ea§mfi§5§a§s§fi fifiggggéggfififigfi xzjfimgesgwma. Ewéfifirgwgfigfig Eggwfiggg IEEEEEEEBEEEWEE Fwfimmgfium Elm Egg Egg fiEEfimwm. ybglgfigfiwgggfigfigfia E ._EEEE%EEEE%EEEE amEfiEEaEwafiwEEEmiig _EEEEEEEE%EE TEEEEEEEfingQ EwEEeEK E cEEE Ewgggfifimgafig Efipfimefiflfiafiwgfigwwfigwfiu Macaufifisaunfi EVE FEE Evy : . . aoow #Ehm NE». FEE E E 3. Huang Egg, SEEM Egg ..,, n.‘ ,

ran, 7ffa

ref

chla

12 31-a7T 3ifiltirelf 41 Vie. 28 LUTEit, 2009

TTEV tt4f4 ct))4 c401•Ja) tii.11Z-ar Mil it tin P4ita tt A aratrita 4 urrq, i 3TM111;

(ellcf) t11l4 TIT tiFTIci 1FIZTC.8e1tii d)7T SITEnt ftFTThT. thitTI MtT

mist/IDOH t19-1 fa>91 Wq;

(yru) 311211W fa9vf We'd T171 it-81 911t1;

(91) f4c4Ivarc14 *SWITh1dnif8T; 3itR

(nr) ardir A cru0n-dqji .arfafr (M-ta tffi zftm

u0011

(3) ir4W 1:4- TrnzA grit *4) frP 4 Tillq I

18- (1) -1- ccr trfAla (w)w, dtrf, ti artireT Prr;

(u) TtiT .4-Ncopt awritg4i wFrrtrr tjI wat.b faArrr E51cr;

(A) "jv4 \,-Ncop .$ f4airn- 4 Sr;

(Er) tlfcr;

(3) OM Thtin;

M tritr-c gpa f'4-unfl crw (N1T 11 cold 43i:cc Itatn

trit3rq wr tiu‘Ler zit S f4T-41) Tt -f2TFT

.1-181 0.11c1 111 \441 18TR9 91cif zzdM TR fit -41 *14-(/. TIT ti13/2,911

4-'6640(10 Thri 17870TTfita mi tictg 1111 (1-A A-61fa- crail 4 irtri

Ci't urea urfor 9 t; 3117

(u) 3TRiwrt, 3TRA Th-f ‘11 -4 3YiTI I

3t1ZTRT-(1) V.A113-(T.01) qf 3193-(7) A co14 71-Cf7-1 f813 •111

1M

rth-t taw A w=1 Arr Turgr Trz,14 vre -a zrf)19

W c 3TRIM-f4 Tht srfaftgrer TiWar at13

sTwk ciThftr-PQ

aTftt-r€1 wa t ThT 11 3TRIWR 61911

Cacti #41t, tlits118 fWavr-ezi Riatrc 321T

ST411-ifl

iTR-4 fc1T6 XR wirg VI I trg S tl sily 311 T11tr91 4 tin it

TEit &PTA tazi 43,1 3Tra 3119T84

f utwet siti fWit fa& color t, Writ WUR 1WI vro

.41.1r iritif tpoift nr Pgra wrIT

latic

an-Q-4R trit

14-m Trikit 4 011 3TMrfwif 241 Th -ehal tl 31RIPTT119

in

Eirir 171 3T2Tar arffitftm f)4 4ti

wor frAlf ffrdr01 (Ira W1 SWIM ram T{fAft WRT R1181133 0C1,

witqfni ER 44 itcro wer coel 311, ? trItEM4Tif3tr‹, facrt

Rif1erf-t f#4f3tal Fe& crtir-4 sTtrA artrimfa

wRuil t 1Ttact( wriVa wtr-fr w lwI

et 3117 ia 4-4 iztff4trq

gfAra Mei) arfrem -EA -th TTrA irdur'&t

Thiz Di/r1

tirRrn, ItI&5T rafitmir aTP-A 191i

19— (1) MI4e4t7W1 A -OA ffft31iI

1TT-1) iiTh-TT1 A 31t2117171 1c8 1?11131 H 1-R) •NM3 f4/N

311q

AF8- fatITTI A tir-4-u fate, •• srurray

-0,1 1

VcTh cP1 micrw ir1.4 51,11.

R31601

1032 RPH Sa.Vitihika_Data I

image11.tif

I I ' . .‘ I 12 4 . am new .W m, 28 mail 2009 - (85:) memmmuemmmavfimfif ‘ , mamma'mfiaaamamzn .tv ,‘ (ma) mmmwfimfizfizfifi ward. mam aka-21W" .7; W“: WWWQ; “t (ma) W W. mam am :2: mm {m m 5 ‘ i}: (#1) Pals—arm 3‘: W21,- em ' ‘3 v.1 1 . (a?!) mmfimmmmmamawummmih uvf‘z - mm j‘ T ; . , (a) mmamquamqmmmmawmm 1" ‘5“ " = Exam 5. 15— (1) WWfiWfifiz— ' x ', " (a?) agaqfim‘laxwam; ’m I (E) WW$W5WW emsmmmflfim; "it i (W) mm$fififiqmzfimm; ! I a»: -. ' - (a) W.- L ‘ l (a) firm W; I (a) mummfiaifiaqmfiwwtwchmufiwmmw memfimfimfiumfinfimmawu mfifimmfimmmfififimmwgm‘ Wafimvfifiaflmmfi'fiwfiufiufifiwfi _ Wammfiajamm .- ; m“ (as) mammmmvmmm 1 " i ; -= (2) W—(Qa‘vws—(andm-(mfi mammmma w: I 1“": ' ‘ WWfiW-imafifizmmmmfiwm$figmfimflafim; w$mmammzfiammxamwmummm-‘vi Wfiwéfimmmaml . . I" (3) fifimfi,mqfiuamfifiwfimfiwufii awfifimzfiumm 11: mafiwvméfilmmfimfiamsfivmfifiafiwmfi ‘ v | !.. magmwmfifixfihuaéafingaamfiwmmfimlli‘, :_;'i ‘ mmmmfifimmfi,fififiua§afiamwmmfiuaww*~\ ",. . . afiafimafigfifiamfihafivwmfimfimmfiqfiww‘ ‘i : ' W1 a‘rrhl » vi (4) WvfififififiwfimQWGWWfiVWGhWanmmum-fiwfi. , m 1| I ' mfluafifiawwmammfimml ,_ (I ' . (5) mmmfimmmwfimammmmna ‘ wiwwdqfiw‘dflmfiéfifimqfiifiwfiafizufimumfimk. Wafifirwfisfifimafiwfifiwmafiafimnfifi . Wfimfifimfimmsfivufimmgfifih - mwwamammmmfiamfigmp (I: .‘ (1) WWfiWfimifififififiTWWWfil ‘ . (2) wfimfimfimfififlfiw ":1 6h} (Bf-Ea mm EN 311? i gram fimm 1‘6 N may (3%: 52': m stun—Est am Tfix‘: and! . ‘ (3) “5175er an (rm me firm, Rim-J: um (fimu‘a arwfn W“! F 1 m: RPH swedha'ikapam l

‘.3.tti TOW 3RTIZITVIT quid, 28 1001, 2009 13

Tr-cwil ti -raRr t) thur sifOrtii ath 41u4 WI \ UM; I

tr-K1T TEtPRI VW Tilt-MIMI 6141f 4 WWII 1 a. E1mFfflPI Vrab:SCII WIT -4 riT T thl--T Wrif ittat-A feic t14 C-Mul ch 1111

tht '31EZIET ath — -

(W) titiO fell-M. 71 aitzurff rittrrff 041 itha.9 iRir timet ;

(711) tionzi .T1fçftrft1.4441., aitzutvl uP4T Thfitz47 44cti‘ trrwr *.fg 3c1-1Xql 6 gri

thcizl aluncF fdiTrrr fl sr-4i thwriitziei thm, f4-44ff 414Th44f ffm fikaRm im wkeft

(7). fagTITRZIE4 31trk f47-117 3112:11IN ffic, Mbiglal&T. 3-ffT4T41 61411 ath .z-fra aiTzr vre4?rzri nu 4N-fur 1.44 4

altirrla4 4 wcr-ifkm ft4 wr71

(8) fafk 1:1TTZT RtNI tpikr aitzrr-a-41 t. 31;130, 3TaR17 (4151 Tuftv witirr SP- 31tZrZri *4 0 3TRIM flew ,(114w eicki

20— (1) Yci ciiefil krT \Lich Tki Iraq -61/11 atir 3itzrrket .cr-of4m za 7111.1

" (2) OTT 34T141% Wat 37—'6fj fthi-avr crix vrWt th41

(3) law irfor-4.' a-item-04 vsa-Pz ‘91-41 faf

12*-091 waTr mci tfazil im utd oro? ara ftzjrth 41-1. 4 Sim .67 -41 30 ThraftaiRzi

14Cch RYURVAlci 4 W-41 way-ori w--4-4i sr--sT siO4.441 -1:1 4 ei '30Iftrit 4 th thTinfitz. m..3 tict̀)-411

(4) • TiT CTRT 3ITT4t ifl 3ecit-1-1 c,r) Wit 1301-0IT-efa 11. i247-4 t Es-r3 4 faxcildvicia Ttthreiu it-41 ritur aci,) &tea wif t wrz)-41, ath .ieviEr4•4,(41 1b) TR) WA 1142r

.<qc cm.). 4 tc441.0. 7Tif4T1 *In I trteiliTfiA 21-•- (1) Thsa14ent-i4 trtell ,(ichr Tr34 "5-Ti 1.14 Jfl

aitzutth wzrifkM itth

(2) trtaT( 3441t, Tiittrzurdth ffiITI 1 wth Er&ii34 ThT Mnr-a aqpftj arTNTT. thai t. 4.0ETur m1,11. 30

apzjw-Kil tri-F9 <041, aml-ct

trfter4 than 9-440 fkgavr 4),< zift. arranr ffi - CI-11;

Th7cifkiiettf titeTT31i 14 1 MT. WRI—ti941 9-914a147:1 ath c0 Mtn- trittm Rite wiTt cb*-11;

(TT) zteil tra tuR fm itar ftwartsi

(E1) 34URT7 (11.4 gRri trklei0I 4 TO 4 .RItarr m-nr, wcr ath fRtjijij i1 tei 7fturIA thtrun wR41I

0210H Sa.Vidhaika_Data I

image12.tif

111.1192 111111113 1512 1111111111 1121111 @ wagging 1111: 11:; 1321 1191119 119. mac 11211111 111:. 11111 191 11131111 Ram 1112 @111 mums 71111<b111111h11111>n11h1mg1mg1¢111fl1111112h1§12u211h ImmawwzanNEMAmm-Me 1111113118 111 11111—111111 .& 11111111111 1;; 1121131111 @ magmg' 1111125. 511.1gmmgnm2maafiggew1nawgb ‘ 911119 WMBEMMJ—QJM 1111: 111112 1111211121; f5 11‘ W11 11111 1111111131: 21191111. 19mg 11111111111111; 111.11 L52 magmg 11111111111111'11111111 1121111 IMMWQWW u11a1mmimewwmmm1m-111agaag . Iwwawwwwmw Jebhuwkmcammwméwwmeghw wamumbwwmmmwwmm mgnynmagyghuagmwmmgmfi . 1u1$aanaggmgzgnw1nugmgug5m wwmmmw1M$mmM1mmm mumewmwmwewwaaw&w InLP—Iwemwewawmwmnwmm anamawwwmhimmmmaeww MWEEM u-Lawmuemaafiww-hfiw1szww ' ,Imwwnww 111111Lmas1mmg‘u1ggwmmamgfig thmggwmw xtmhwmmihmmmawnamm -'N&Em-$wma$1mamwymm&$mmwg Imwmm1mw- UEPBEIEMMMBMMWWWWW ¢r1ammgng$mgmgmmmmmg Iwwwwamwm uemgflmraarzunungsehymmmmsewgmgmg \ ' Imam-$1112 mmméflMQlMQW'MWWEM 11111111111111 11am1191111121111321111112191n211h11a121111u11g11111m1 —2111119u11g1a1za1e152;11211211112111mm11 - . W122 11111132111313.1‘1 mgpn¢w1mmfi1lwmaqa 111135-1922 11111111m1e1m1111212mm11m112m$1191121n 1.1mm 1-1-11111L11°11J2m1auu€mmm(auca1mbwm {l 600E WSZ mummanm [Ema—"NWWM'ES “MM " 1 —1LZ ‘ v 11‘

1 ri

Tlan

‘N.). Wa Wrq I

3121171-111 -4

fd‘aidenew aimitra .0121T ar-r 4,4u1Reft fksfau \T . colt siJ .0"

31C1111TeL ff111%1 23- 1-476.WITall 31E211U4- URT1 3R4 milmft-LiI MI Mr? 3N 3-9-cbr)

ur met ft.Fq-q cr4 vrJ t4t 0,11 Mit

ffiu?dEflttTI

aTtacri-13: .

tiegscor

24- (1) Tf8 STRI 661 ei CI 1:R IL WtTil I

01 tift VartiffThd. Thnt 10: A-4t 'fii-flig di *1 4R41 T-d-1

ftitu1 viiq vr ct),)cii aerazi .04tieiT MT

Y)til OH 14414 ctr Tr4tft aT2Tar ErtTAt g ti, 44 %#t

e41(14 faISITIRMR M-4 641- 0-4ift 11T f4R-11

lI1'I th919‘‘i A •il,?‘,41)1 TIT .3i1I4 4141in icI'1t I

ffir if13Q.m. ff401 STR-1

e.11c10 TIT awirrum in. 3r- 1E1m mid if -

RT8744 ctr•). UWI 19l faa-T4 *T1T I

gi0 ZIP-1T 31:raPtifi. M ft-MK .1-49.11 411%.416.111. mi

m-444-c, T11eItT m 44m- 91tiI T fflA afr TUi‘m.)

em-i aft 1491:11 7241

3ft‘3tIck4 WM14 37-IM 161-F5a if aigrr-fFT m9t &

El

u24i

arat van fA-c, cvN,;141}31-n1ri:,

t41 fitM, itaRitRit TWIT arrLT ;RV:

11.1 M;(44R1 714 I

Mit ITRWM fi6iFagmefq MT, aiur - EF-0 ffi.I91T(1 LiffaM:l .

c1) al TMIThIM m14da) 0,411-4-1,1L1 Likr t aT9t -c-s.

31-- 0A1WE f4tai-o-r m-R-F)Tif 3 Mtartir met ftcht if3ldmf*

m'r -41t Ar-4=ft

W4 '47-f 061falrefamnt.a-,#1 ae

-111--d7 1-# thRR (61 -cm7, -041 tordm-t) c4') -Wm

0E41 atroTtr- cfil-a

Trofticur-6-ca T12,577MMI-

1032 RPH Sa.Vidhaika Data 1

14 dcH WT 31-11tifV91. fluId. 28 14TM€1, 2009

al. -€Rtfa 124.41-4TI M-7 ft041 I1T1-18)• 191tC0w ffiMct) irr S ait 34-21-ar uur-iified-tht iM Er&iftiy.

-01}.0 WWit m-RA 4-1-;mftrer flPIit 47140 eiqi wi thfkz-q-zr 4570- mrirf<i rrthfrim ifl j 74. !

• 8WI. 3TRI(49.1. M f4tft 31-421. -WI 31a 611cf gg 71),

tlteff TiThf vatiRwifid,ffi infM--iit fkr, 104-

941611 a 4 ‘34k4k1 (3) M 3414 T 111ki 31A-41 71-D0 MT nil

fa,441 RY414€11-6.1:1 Mt WM 111)614' t Wift 1:1&-TT4 ThAftsiTi

f4Ra4 0,11, flv-iTmet wtr if 10-1 Eitai-r4 fis# Eitur

a-Erzfrrr co,<•)- m-r -tft t

22- arqi 9-rItim-rft ffiY91411e19. 3TRI liliaMINI MT 4164, 'n.icit 1-WRIE ‘24.1 Witzt iItj

image13.tif

14 am 9723! WW 11313. 28 arm), 2009 (3) Wm ‘affiffi Eat?) rm— mm figaa an W77 @164) 21—5 #3251913} fiWmemmmcu—W 2r?) tramway Mafia mm) Efir mm m 1) We! 1111161)?) WW *1 $11)qu (1211 BTI wffiffim uflfiafisflfix'l 9mm rm Wfilfii m (4) fiafifimHEMWWfimmfiEMmfisfigm Wren 11% 111, 2mm, fin?) (KW—Hm In W W 2r? 1%, fimmfim(a)a§mfinwfirfifimfiwanqfiu 137m 3), Wm afi 'l-TI'C'IT Iré‘rafiafi 1% 1w Wamfi 25) mam WWW) 22— (am if} 3R1 Ma) an TIE—La???) wfifinf aw Wm M mafiamm‘: aim—W WEEWWWWafiWWWfi‘Ifi J mwfififigfifi 23— . {333W $ alummfi aw 3(er 331%an 'aé) figffi ST)? 37126) mafimwfimmmmmwml ' (Hm—U: . W Imam afi 24— (1) 213 PM WWW In 51111 3%] ngr (2) WWmemafififiqfifimafimfismfirfi) mafiafimwwfimfimmafiwmw' WWWWfiHW‘mfififimzjffififi WW 2F $2)sz afr 2131 W1) 111 mm ta Wafimémfifimwfiwfimvfiht ' (3) W man—dz: 3 W, mi) wan-rm a‘a 1’1" fiem Em?) am WW m Wow EB 3192mm 111W mill 91'- mefifimafirfifiaflgfin - (4) Wm gm uaIw'erfiIfizr‘: REM (w 1131mm Fm" WW, HEIfiuW$mWTWVWWWIW mwfimefivafifiumfiwwwmzfimrww 31W 3?)? WW strum? Bwfi ma) 1) MW 317m) 1154*) WI? WWfiWm-‘HW aw fiWI$WWlm film (5) EH)??? Imifiafivm m fiu’lé, WW am am W721i ““1“. - mfiré 3711} HRS? uragaqflmfil (QWW, WW2 WHEN sum gmwfiifimmffl? $35 in W afifizfi I) Win-Wu U? W ah) I) swig mefifimmwfimfifiwafifiqfimfiw afifififivfifizfil (7) 25rd fififi,sflWWfiWWflEn—dfl zfififiardfi 1'06? GM) fifififrs; 4%) mm, Q14) Wan?) W?) W firm mfifia’tmanmu’ifiafin 1032 RPH SaVVidhnikq Dan: I

1/43TH STtZT 313111113u1 -11Z. 28 rh7qt, 2009 15

Th-r4 tTitiR 610 ?Mit t34 tale14 t144,901 wr Miftilf0WR Ult 3c1t1RT (7) 347 014 ITRIR WA. f4bT TT 3171•FT1

3P-TIT Eivr 4),(4 If 34*1Thci 7-6Ti4g/Ici4 WC4TO 34 331 faiN itR ?NV c)4 W 81.8

42,WfOtrf id \nEfl WrCAlt 39'1T 41" fur wr 347T tit WIT f4no Wr t

,siAtikt (2) \i-4- (8) If i2M-fit ITU M U4-4 t-R A, fWill Qmiw viA w-T;) 3Ti14b-& ro • t

ciRt c4-4-T-d 3113- qhciLlia .34 Rthe.mtjcM4 48111 1141.5vIT M fOlqAct)N wl 4140 A TrW9T TIT \J•riel mR 3-1.:W

41 wifOr, PaR it(Em ZIT wr411r liIc1nui 1.( 114iVf iDEfic13/4 f?4- ) tWA) aati StMEiti MT 1-14I-4 v11

Trr NA m84 f4gth 81Err, trit 312T4T Triv-4t tit)

1611qc14. If 124-4T 333M ThAt71- Wift 4,14 trrRiRTho 312T4T 434 4-161faVicia t +fief MT 'Mg 737 fac. 3ItTOT 37,1* m:1?1M wrt Thr8-9 8R--) 8514 iitf8--r . 3z11--w-R• ctrMT

I

(1)

Thx4 it<ON T‘T rOfil ti4 gki rifiTT 40. That

961 Ettegf M, 17 3:1-M 3.17WFU \31-101 747, SILIThYllefT iiit

k3i4t4“ 41 t 3t) Traft-crat8 tar At 41 ttarr,

aparttlA ci,r4 tin8T--qi opt .wr ctic4 3TEM .t0

4161 welt{ 312MT f8ccr AtE81k-o- fb54t 31-1 %LI

311R174 If viit4 <WO MT 3*iMri tiTT I

4 •Outi tkchk 3CItTR1 (1) M 31047 Wray{ TIT ulltl 1-317 mi

MY-4T! MI V4 V31M1 114-11 1161f441d4 M VT4T 44

Trec1?f9 Tyr Thiwr cw ?rat EIR wiwt wkir fkziwr 4),(4 4 3R-8:8A vt 98ifavicii4 t151 11w41 .134 ram IT v114 1-1414 VEFfteM tIchclf t AR. ;18-zErat

wet 38-q 319-ard 81in, 14)-ci fAteituf VT %Jilt!

ti 96ir1icitt Thnf ailti A cril itrO tirdwrr41 9 81 tiftercr

6 7 311:0-47 q,ir 3i13 i ctU cbrei wItrri

uw.TRT 0) M 3T0117 fitaiDT ZIT 7:11 SV W1;4 M reth NOTE -0-1r4C1 M4, %fact 34‘Wia 1908 W 3419 fW-311 wit ER

f.C4R EiTsk) vrEraT qiowl AA aft W Walti z i4 IT icuayilt t w(cutt chig4i 8,1 TR? 4,4.1 fez) 4,,(4 craa9rif ftfSA RifmAn $1 Ain SRI( MI 3t1R UTPTT ZIT ntRif Tr.; 1414,41 31itrdT, 1973 Mell Q131 345 MIT 46 M 312n4fT1 RIWS -414100 tpisrf 3TIR

\i-ic) TIBET Tht‘ 4m-(181t 47617 8-Erg .Qc-ir wr)

10-193 3117t 228 312T -fr-fftd Ruitmi wziarct RpTA wzliti

71:1 tt.<01.1 9611-441e14 T17-7r-rd5 q3) iftheluf Z11 31i' 151

trftufT7 313r. M-3 3T-M1 3113 fth-itm1 wrifwg) W

If f=4-kw t 7TW-41 aiR 31114167

I

sraTtrIf icciIM fc am-gm

Mem v4 ufl

1032 RPH Sa.Vidhaika_Data 1

image14.tif

lugs; A mnilmamnwayaggmwwwgmy' ' '_ x my} 1;; {gimme gem. gm {Lugzue Wit & ugh: numb , ma 2-;er U2 11113th gm Lea. gamers W W tum (v) ‘ IW aim gimme 93311: a .p- me 3; 822 we ESL—1MB . @ngaanznurmi 1511291.- uzggegmmmm zwtmmmawwmgsvmsvc ‘ mageczetmgamwmgnwmmmahm m‘ {EJWQLBEEMWW$MEM wgwafifiwgmmeLmeewamwgz kfipwgwfiwwnmmmmmflfig . k'? wamwhmwoetmwmwwwwmmm IwmaefiisgPQ$w>$mmmwhuawae(t)mnm ‘(e) Imwthmee'w ’,y Imuhawhwmwwawwnawm < 3 $EmmMWMW'WWJQMtEmEQ . A wwwamewmgmmmw J4 MWkaes—AWJLWMW 1 fiwwwmwnmmmwm utawawmn$nmaemmwahuekflémw agraamnmmnwwgmmummgn (z) . Immmgwmgm . _ i $MHMWQQQMRW$W 'mwfiuuemwmmmwwamw me'm:wwm‘gamgau Mxmegzemggméggmgémgmm (L) “9:. mugbmnukg ’% mwmwquwzwwwmmm WMMQMMLgmuwMWMME whwwwgmwmwmwbw memummeww$musm *' - mémwflm$wwM<wAW ware; Igwhmmmmmmummuw) 1213121;ng —sz gmzangP—Mh“ ‘ Inggli ' &Q&MMW@W@W$W 3 iflfléhéfimMRbQEM-W EBB—41h. W '_"° < A g @é.mwtikfl%1§fi@flfl mm 22 ‘ I wwww‘ucbfietazemawm(a)mmm (a) ' Immwwmmmm ‘ - , J mwem¢meaflaxfixwmfie ’ alegwmmmwaW$mw _gzx\.;:»— ’Lamwymflummwmmmwm ' J M luflhflwamwwszmwwwomm ' ff'j“ mmgmAWganmmgmhMmepam s1 sooz gm 8: um». mm»: mm m

16 3411tITTRT 4 11/4rfC, 28 Lbraft, 2009

#17-TRT (4) c 3Tt7 LIRT t

tlt-4-1f -0 4 cr,,,ettlit vii•ict7R1 trrc ar'17

cm (71313R col R1-74 tNct)k M iThm-tur \<1-1

crgilgiet RiTW A '<No, tkc4,17 gkr 41 IT Zffl wotr. 44

W7k-ftff crrfli

dc4lcf, cgeiqf u)tir fi15 Iu4 *1,Ictthr RITT

fkNff cO, \3i-r sroRr 31- 1 9)149,1# LIRLITia741

4)1 9161 Thci v114 TEA 01401g1 Met ft ft

La -RflT *Nct/K MGI Rite #g ft-reso-c-rdiT 3Trfa41 -th n'T

Plhciwrzr 44cger 7-61: mbr -1 war eNcr,N

ft—it co.< r ERftitfkv--rOwraw warm-rer crwlw

4NI-0 t Mvr kw-t-et t kffr TB #i='4# TITUS) 30

wqrtr *vrItt-11- QI WU- A mar sir) I

(5)

,<Ial 'MOW! 661 elIc,10 Ll197 34#41 SITTP=1 t fd-trup-r

zrrik *A-11--47 A 4)) 3g-v01 Ai-Rr 3-4-T51

27— ItRt 661faCTIc14 LIT-41#T RTIT-frcl# cIU alf4R1 3#-R3.1cbI ch

AFTT4 iii 31- 1 3TUTILF Trr 31-R7 m-4-4(ft Trgrfa-aido g'avr VI lIT

cr-a-zr M trz--4r-a, M 311-1 mbrRI fo,41- zor

3T21TIT -0:1-4 30 A- i)PziO. A Pwift IffrTr r&-t

3TCRTRY \+04 k cr/) 3i7TTR, 517, Lbr)ti Zfl it-R# Vt7R ml

T411 -1'14 W). TT TRR1 \ ,̀114 # c+ ii 7 1171 afr ;r-

zn LITWI c4,4 anr

4g:

,Aaqr 74 r9-

crrok tr7 Ilcrr

3-Tafg;—•(-IId

qRf q'{ '14 &aft(

trftrd719 cl V9-14 28— (1) Ycl S41 ;raw LiRfltrA ,41,3-4 0cok gN1 34-10-7711 gi r

wtM- -q-Ar4

tid *EFT n-1'1 t1 7# TT 3iTtRa# PLpi 61-11 flch`t

lii 3LITIRT (1) A ?az Er W-1 -4 izhm- ziR

:

tritg wei fst vr10-at

IT13-2110-, i1iu1 TT +16-f ch) TTITEfid#m Cliell (4-2 7fReATT TN

Oct) ii A7fT1I), 3dtr 'R;IR#T6 (1,15 ZIT wflfl9T f0TT9 fbt

Thtfit UN CI CP CiftWitC iM i iiRci I-PO(1'4 117an fl RRT

.tnLf 3TRITT-0# ctr0ml T - R21r

er aifltai fTZ1I 0 44 0isii;

Th-vR fth-trr Trzrr ?r

104-51 9-Em-rwa A t W1 old trs[ 711 TRM-R,

3462:1719-. sTu0R irr 313TIVF1 2c1 A Ths-q -CreiLI ar ;14'f arpiliT

fai# tn-cr ta Itch-rf31zn 777T- IT #14111 T#IMI

3TITYRq 371# giq fdt 717) fre4-siazi&r -12-710(ta m-,zA

-f-'6-4 4,14 0-trq re4e&azrf * t) i aiiNWu

1032 RPH SaNiclhaika_Dala 1

image15.tif

H gm, ,1 { € 16 w W W W, 28 W, 2009 { (5) vammhfimfir ma? asié’wnfi fans] .2 Wfiafifiafiuffifimflfifisfivgm'fi quafimWNrfiqfiafiwsfiwwzflWm ‘ ‘ WI?! FE W Tim, WI? gm Eh an?! 211??) Ham as} W'WI (6) Wfi,afiqfiifiwzfiwfimfiw%wmm Wafi,wmfiwmfiufiwmafim szfiwfimfizfirfimfiafififiwafimm Y 1 (7) mmwmmggammamfimm ‘ WWfiWfifiafiafi§fimW® WWWWWZBVWWWE, “ wwwmamgwwmmm 'gi WzfiMfivfia‘mfiwgfil {j (1.; (a) Wmmmifiwafiaawmfifififim 1: .‘5; mmzfimfimfis‘fifimfifiifiwmwfirfix 'i‘ , Wfimw 27— Mum—amnesmaa ammmfiammm :IJ ; fig“? meawmmwfimfifiwrfimmfiméém . W W$mgfiflfimafia§§néfifiwia¥wfifinfiuafl if" awawfisfivfiffifiafififiuffiaflwma§fiamwam ‘ j mamfi,afis‘3mcmm,qfifimfinfiummmafis‘m-u ;‘; quinédsfi'l‘n'g’rmdagwfifiwlrfiummafi’ifiafi .- ' DTQT‘T'TWWI Mix -j j. swam—m , j WWW 28~ (1) WfiWWWWmWImI i WW WW1 :' (2) WWW—wwmmmfifiqfifiwww‘m 3": mwm(1)fifififsaqfimthfimmmaé€mfim W: ' mwfi3$fifqfifififilfifimfififlfim®wflfi qfiafaflrffififl’fmmafimffifimfiwafiéqfifiwfi www.mmmfifilfimWWHM mefifiwfiwfiafimfiaufiafi-‘myfim W ‘ ma-Wfiafimmmgfiiwwmwv1éfiul _ wasmwmaflamfifififimwmufimm ” Wamws‘rl '1‘ (3) wmmfiawmm$aagmmwm¢ I; NW,WWWU§%€fifiWfiflTafl§TIW3W ‘ 2i? fiflfi flan—d m W21 In 11m 211 {trim film ma $.31 ‘ V W mwmfimfifinfimfififis-«Ju’afimfii‘afimfifl; :p i mmumaawmammmmmfim 1032 RPH Sa,Vidhaika_Dala l

14 NH cfrii.) in 31:RTRT (i) ZIT 'OVUM (2) *I faz 4131-4374 . • 3-ivrifuff cm-) VI R.O-RT cm.) A Aar Th-R Titri) RA

4 f q4 urf4trz $11 300•31-1 3TTIT-6-q Th-T71 faw& th 7F-R4 'WON' cI 3fr .41-31ka4 ii3rM1 ITT wzrzTriT VI 311t1T-C (2) 4 Mit tlifikwi ThT ThAT9' fkvu9 Th-V

(4) nr "crwro) W 31tlh g 4RM-err 4 wc-rET tri-clig f0-34) 4duer W faq 377-4T fthm 3:r0L4

rta-tur 1),--&?scr M fk.; uzr-474 1-0t; 00,1i

(m) RzuRcarmer it aTRTAftel A ftlfr. /if*trzai at 0

f/ufaerrocr aawritErl, vur aTR:r 04urRzil 1=1/ 4P417 in RTh 14f4 iw io 3T2TOT (114r -/hm-•-fr

(Tr) •(-1 4-91,11.2t ‘iL111q)im srm4 14,ur

(Er) kit4ifQut 3.1-t am teeter A ctigtf #11.

(3) M fo4W 3Th.. 45ifavaieN1 z15't fq1aciici Ti -1411:401( 1T-C17 F511r uII¼ 31Y

Riiict aTti'MiFsII .Qtrr fUtratw 04tr fur n

t'zcatrivicr-gru sr<r-r iM 01,) criel) ‘3411- r 317-{1

strum RI/Ocul3Th ffi 3T-i-dr4 athz3) smr4

cm. Trr PTtT 0.<4 it 3rn 11T11 wrvrit,

(u) 1'0-u-ft-ark 3TuR:17 t q un it ffi4 trta4 fqitlIjt I 3TR:f *IS Fe/Titer

014 wA

toorqferl, zarm-Tref,• fcucRidt tr-4-4 ii

1-111k1)14c14 IRri ink iM

(T) 4terra4 ml trur aT74u -Et WIT Pcnizri tr114341

417 39-41-RT1 tr-c met vr Th-gWr met tit

aft m-dair t.

(A fqicieiu S 3arThritt (tclirti Th-1 ci"()

0r4uirquI 6t,) A -sTF4fr \i-14 Terdfter *13

acir S f4-4-7.T9 xr.1,

(z) aiRT 31.41 fa tift aared-zr4 ucr ErF4ffier4

utrard fa,a vir-) w 14,4 71Tr-Mit I

29— (1) Tfl 3t7tWmtr it -34-0791 31tn9 •<6.1

aitzrthil im 014 trnwq colii4 7717T -1 -€11 ni-flafto

tiincf ZIT ‘3.-14 rth—kft feIRT WinT 1-4)4 7T tru';'71.

apt :—

Imo urth- mlIA 3117 'b-ti ki-Rbf

-111110

f1hflclQ cr 3,r41 111\-11.r1311 t IFiruitINI it

fè Zafa i),c) iik cija 31t21119 14 q omit

ari-ayr Trterr tTñ41144 •

\IZri .-.13Q9raft 1Aitcri-tr1 3117 *Warm

1032 RPM Sa.Vidhaika_Dato 1

(T)

image16.tif

2mm M w MM mmwna _"7'(n)- _ 'mmwmghhuemzfléle (1;) 'mmwwmww iaQEWWWW'MMuflwW (El). mu: Mhhfiflwwlfikflflbw (m) . A —:2;reke '{zwmwmwgmwawmw asyiamiswmmewmwmww 'h‘éwwaamazewwwwmfi ' Awaiammewwmum' QWMWRELEWWM (2) wmwwwwwwwmw bw<Mk$gh®1flEW$W (rs) _ 2&me gewmmwwwwgwfinw waeh‘mmawwwwmwen (ti) ‘wwmwww tree #33 W913 W mam—m (a) 'wmmLP—wae kwwmwwmmwwm‘w yumww$mmmgnww (a) 'wuemwmgmsewwmw— wflwwwmwmm mmwwwwmmE-Wg (a) ‘wmwmwwmwmm waewmwwwwwwm wéwmwwwmmgme (a) 'mamamgmwwm (n) mmmwwm (LL) @ummmmmmfiuwwmmmuagw aunmewm memunwmsawwmi (a) mawmmwhww¢w (ya) Imwmwsawwgmmw wmmmwgw-Mmamm—w KL haw hi km awe $ M$ W As Immuemtammummmwnawwwm m(t)mmmu..gtmmggngegwmghum mwazwmxwzwhfimmzmmwmwm almwmwmwwmmmwwmwz ngnmwwmmmmmmw m,/A 4 <

CL •

! eci

( : 4,rt:

ntro •51<`11E4RW 71-We-, 28 th—COT, 2009

ffiftittft wan- m-T4r, 3t1T -9-9Thcr 3re-m-a- ffitrfft aftv van- Wa 3117 ART Th-T4 TiTnj rr--4 mr4 click 4-ma4,

M Thy-ea-arm-a 3TEZR1-q CNTIM-91 IT4tei-rart 44-r anT ftreatTr-ma 4-4ftmi, ft-i*rr34 at1T crifrar trwl * fit 4404 mcimk ar-4r

arfroTTif. arnrMart ftarafMar, tral ar'N 40014-0mt 4--c-r4 m-R4

(w) trfra-434 ft-ir*. 4-4c Th-*1-0 4-mal4. 3ft? fkgWr 4-ft at1T Elk-TO aft ar-T414-0 *wftzlit,

foafhirma arA fkar-fr 0 4-J, (w) Ree-Fr urwrar1 Thar-fr, 3r-i-r44-ffq afri artarcr4 fk4 a-mat mr4 ar--4r fola vsaicr4, aft 3t1T 44* fta fq-41-Thar 41-4v fk*r arzaa-9- trro:-4-ffi-M mTffr,

ttr 0f-vifizt ft4* fta tOffai,r utr -er War Trar . f49- m-4-arl3t4 n-f44 3it? trItaW-at. artzra4 31zZ1V9" N1-4, 34---t-srfT14-a arEzra-4, fkfOrfk- soatirr-s-rar1 3f1T 31- 1 414roal wrcr-m, (a) ar- fa fa-g4 r4-04 art? Tipt Trfkfta. m-?0- arRT ffinfterwitgrfrwTrrit Tr-eza-Tr atk Tr-614am f4-Rt ttr ar-R:r fk-*Ta WraRturaa Iraq

Titrri fty arraza* 4401 TET-44r afri

(u) 4-1449-0. &TA-T*1, 3i1T TriTterWM Tr-drr wr4 ara 40,544-*, (14) 31EPTTO atly 3.1- 1 slew mlwrfr- Tlirr 0f1 arRT ath w TrIr42m1 g-r-qT t ftz1- TR 1 •

3TE/j1T4-31TU • aritt. aiti -thgrr

1*ra/raw m-r uffi-d--4-ff, wr-41 Trftrra t.f4-41 arsim

30-

kaR War warrr ftRcr-* ar- r WR4 t war, foafThar-ea gm 44* wqtval lif4 ibir fka Tit zara .

nr crwrT karT .'war 4-ar arfif-* ladaq t-aRma 0 01 ft4r-*0 4-Tr*te wiTlif War warrr frflzrr 1 /4 1 (3) utrtuRT (1) arzik AZIR Tra ;r1W-1-4-9- mrt kr-4 sedft- 14 TfTwrv aRgff warfl

r-r*-isrr titan

1032 RPH Sa.Vidhaika_Data 1

(1) Fdr-q-ftr-ezf * a 4-4 MIT 4w q,'4 4134-a Nvfi

31-

am:ThiW aarT fka w-44 atIT fk-Or*, 444p4 f*, *at

image17.tif

l meg“m'_wqpy/\'FS Hem ZEOI yaaw$2hthEbhafiwaemym$maamg (t) —w mnmmme

s -cvz ;raw amrawur , 28 th94t, 2009 19

co Irate Zff ti% a4f çf ZIT Oawif gkr, ,ek47W:Ve fkikm vart:u ;ff4- azi m-23. 34 m-a aft3.st-ce awl 3:1 araRrwr w9-41 atar atm mei wNli

(2) rnI atgr at gcl-P-1,1 k'W 'MTh. We tR v)t.g tfteir efiat Trite • \LPtcok A chid tifer4 tkruk e4R 4,14

*33r34. autw azf 30 %Olt IMF A Allift I .(3) qI1cna2303T1 w <Ivc‘11.<01•I rgwr 1"4“). mTiteruT 014 Rc

Miff 4 a-ra ssti4i1 aft3. 33;1&94 az• 4,14 trt3aa it4R Th.")-4 v4ItObk Thr ftt wz14

32— (1) W111 eve IttcrIPt qxciRviegf *WI'ET9' ZIT Tra: 6114, Sufi!. St11441vIM TRW crq ftI1ct AM EX tri

oni \JINEItt *IQ 144.1ct), RIT4t4 mffi" <AT, ki(In TraT zrr 3arTiRi aarm-rer .

faxafdvidir fa*tr atsa altar td,t) 7r4 iiPj .33-ttifr

fr ar 1St Rmlemi t)" %TH.) tri ev1.1 tket)Pt faxcnviclif We 3TRTM141 12 71A \Alf ZIT OCIrtirt

Litho (i) 4 Mr& 61R. Sc44 ZIT S.V.141)v1-1 Eaff t tiIP qflcj 3I-1 Zfg *Me ‘0411fiqg glue gp<

fkftW *FBI 3TIA Tff TR! A P:ItZ I

a 7T7:1 Ittcor te efffii eafAt 7T1 \kr<coR URI 3FIETTRar &RPM TTeTt crre4 .*12.6t .iccrtcHil o8e4T. 71V

3TRIITR Gian4 WM..zrr. ar-r In- 34 ,Atil *Nchli gwr Thaflicr mc1 7ra, 'net fdnir sittaiirr

mftmrnui* 3i

i.

firttbil a ffZ Wr1 ttra

193i RpH Sa.Vidhaika_Data I

alumr-91

irectuf

33— 0) re 3TRAEPT ti Li 7 arTh-afaa a3zr agaftra RicwL uipict arft)-m-rft 3413 %al-acacia * terw-fuff

1-1<ta, zrerwma, fiafaa

in uti44,

(2) we TIT arferlktra ZIT tantifif tichilmq 71 el' 'rtocn 312/4T

31-1 ar-13u3 f4rat ThsOrr *I'v 0)4 \imagtf cdnir zrar atri 'Attica atW 3fq1 34-04 3FalTftd cot -1 Alfa trftqt fad vr71

31101.M It4Thwel ; 34— 0) fdzafacimEr %RitlinO*1-4ta i*PH4 tfk gtq1 t 17t eqefi A %A aimft9-* ?e'er *1 14 q11Zr met ft.r tit 34 f3R-tet Ridcr fa ar(41 n TrErr t,a ftravr *1 M4),(4 araT “414cr suRrm-rt -Err 144,1a

tiqta tar 3fR We area 31a1tr * f=-43 ftt - 7rf4Tr f2--frwr Pa@ mur t tictu V9T c1L

(2) m-4-4 &nu, q4- fRft 3r-4r Thcnitr 34faARr -1; faxardema WIM-Ct egie .4U awl

Eno5Tt 3IP1dT Wt. snitwrft 4•&EA zza zrz it ag 434 Thom mr gregfer var .3g

S1

image18.tif

a . aamaamamraaaiswafi, 2009 19 1M i Wmmfiawfiamwfiafim,fiiémawnsa g , www.maaéfiwamwmafim 5’ _ _ mamamwmmwmaml . giftef‘ . (2) afiasamsfiaaaaaaafiwafaaafiamafima‘w 5' ' WWWWafimafiaafiafimfiafiafis‘ fi,a§wmaésofiama§1aafiaafimfi7fil ‘ ' ‘(3) mmemmmwwmmum—a amfiafiafiasfifiaamfifimqfiaafifilaw . , Ufiafiéa‘tmawaaafiafirhafim V 'mm 32— (1) mafimmfifiwfiamaflaammafi- m,§afum§aaam$mfiaaéfimmama‘rm ,- amafiaaaammMWMEM - ‘ mammmmmwmem. (ammafimfiqk‘ma‘rafifimm W‘$wafiafiafi,fiafiafimmafimfi ' mammaofififi‘fiafijgafamgamagmaw , . ‘. ammmaaaaammafifi%aaaaaawam " , ' . wfifififiwwfifimafiafiimafiwfil (3) afimmfimfifiv'Mafime mmfimmammmm i mmamamfimmmmamm '1 .' .mmfiafiraafimgaaafimml ' ‘, a mum-a? wmmmamafi 33—- (1) saafafiuwaafifiafiammmaawamaqafiaaa' = .fimmfi’ififi ' W.W$W‘WW$,W ‘1‘ Wflm, _ ~$aawaamu1afiafaaafl=ifliaagamfifi - -(2)' 'mmmmWfiWam-me ,f ' ~ - . _mm$mmfigfiafifiafiémm wfiawmmmmmmfiamfi . H fiflfiafiafiha‘tfifiaafiml _ mmw,,u— (1)' mamMmmm—zmamwaaw .333 -'Wafimmfifiaafiqfifmmaafimfi7fi mmanmmflmafifimamm amfifiaafiqfim'mmfiafiammm 'mwmmwmmammmm ‘. aamfiammmaafiaréaawaarm. ' "V(2)fi§mfiamMWfim$afififafiwfi H ' 'fiwfimammmwfi,afifim Wmfimaflaaaafiamfima i. aafiaammaaifiiaafiafimmmafitawaal 1,032 RPH Salvadrnikapam l

20 . \i-ck RkVT 3MIEITPT I1/44Z, 28 T3N'9f1, 2009

artitur th-4 ct“; 4 trt

f3Y<I14.4Id+-1 es-4114'0cm zri 3T2rOT 11'11-t mr%

<pi cg ci)crcr Tfr MT‘Tui 3TRITER4 fTrr — •

() -30i cOW Rfr*i 3::7-tti I vItIch Twill4 1t 4, -a%

(RT) cr84crit % ite %A arRTT % %Fr -1 -zr.r t, .11 ,8( ci-, 4 r:

8cpgrz -it en, zu

(Tr) u-%* ,t14*L1 * *ILI 4 m-rzfi m-7-4 cua f4:A- er frqt--4-4i

-4m7ffitsi% zrr fte'oTr % colli Vt e, zrr ••

(zr) mimet coMcilt % 4;14 itt atikErfktf 2fr Rma-44 Arri- : 1

irririf7T 9N- ct)) SPIT9 -9. 9501 tr I . i I/

chi trI3T8-, wIltzo- aftz %a a4 =go? %-g--fitt •e• -%- forrt -8u % r---iisi.;:i ' ,

al-114VE tl- ta19-ftleiLl t it-tf Triftt-Tt TIT aTm F4-t-mr m'sr •rigrni 31:!.1

nr 3TITTR 1:1N. it fir er tzt &mu Th-% Rr,,g glq prT t z% „ I

LiPtm mcr •ii-r 4 Afa•-- 3TZTWell -IE.44) 3TtENTET e 342T9T -7-1- 311TI-R TIN it: ti

9t cheict0rict) 31rnN"9 wr ttfr t arzmr -RIA tfir. tit t c"

g 1/4,1) factf-asuc-r% * ogto * •Iir 8c1

- r at IN fs# er t frrearrFzug7r v g ccr 'zrr ITT mnr 710

Cr> ni, 1:11 1411 lUi

;

37- La cr, 'elrmm ‘3a fm1 (4)1 er -RzuReriem*fwzir wri%8•Ttler

31RT f%m-T% ti tikich.<-01-1 34 Pond VT F4z141 •4-K *0 TIT ‘itichf

6 tf 6 ct) 4 k t ZIT -1 a am--0-r f0-0- Ivicii4 t Wr mr14--t-lt Z.

Sit m-r cpld -101z-04 (-€* 3:1- 914a mRfktrq m't f0tPARRif..

Trqrfkm ct;h mm .1-fr t) *,,,r artrtzrg 1% \l‘8, 8 srtim N-10 Millil ,

311-€11 t TIT -16) Ul ‘3cra Rtm t&rThirth cb) 1% -fltz -F .-Err %TOR atlti

cgclifk-Or MI \3 tf trzfezrzr aTe- T tiTT • •8••,

T-TN-. w%*81-ziF cpli fra-tir - -,, -I

(T) ,er urtru % vifif It mm icrt- a pi .1iivri ,ni ticocir 2Tr.

flit! tr aTf0-- * i-rmcr, zrr •••,,

- (R3r) RYcnE.Alcia * ltit ;iff0--- rtr zrr arru-t-rtr 3T2T6T a afttl

A P-i WI. arrOM kr 41 i''-zrr w%Trri

387 NWT *I .1 zIT RzcAwqm TIT 3-Tit itti 34ThtTt, Mlic.bl't lir -34. ...

f4m-Rr * -1t-€S Sr zrr cIsETIF 9 -9T??C 94. LiRILIfilt M arfit

A ftt i-r- r 342T6T f.--% uri4 *f'67 -r- 1:75- 1 Irr amthu 1W1 4'10f

010 ;RRIT f -tir r.31-m'm . 317 9 cr-,1 3T- T1'0-14- m-(4,00- '

,

39- (1) facriaS11c04 t -Th-0 A fl g flVlcl SW4r vil- cr,1 *Hi

a * WI 7th, 31T8-89, Tp--%, 3TT-0T, 0-040rgl, TITh#1:ATI' 3T:r 4t0I‘.4 3T2T4T face-PaeTrazi gi% %mcb

‘ \fro-r

i''--41 ,d ,(-c.• mbr fse vitt met 14Rr, AIR

w8Tftrm t e te Tilitq.. 31*-47, 31W-HT, 37- a7f, M-Ptargr, IL

tictic-0 3m--0-r 4't-c1Iut t &NM ,, ‘fitt{ A ve0ft

itar :irranir -- t)Lr A -txt-crr mnr &Fir aft i-4

it(u tP-TT ctici6I•1 t PM %Tar * 'trig A mtr SA co Vet, 1

- -1-4/3t ‘311 1=& 411.0 ilsi mfEr ;177 ., -61 ir41 tr-idt 8- 4--t 7110.11 1

-9-74 trdt, -11.,1if

. (2) 'wt .5 ft-41 al-R--1- 1i -ar

i' --fri.i.4010en---d-z4 i;cp ITU "9 e", favq140c-14 m -T 0-,1 7,4

_..,- I•piE

.< \•-d• in- 31- 4 311;93f itN'Itcl 31-9-4- VI 3TITTINT (i) cr .

..: . V iPid 9-1% u-m -R:w Mr - r•Tr-5er• tr, cr-in _0 -4:',

, •Ii: ,

.•

--fpl- S fatm uP-Tr &1-4-8- R e it4 <r) ,) * fA•?....

* ‘Lem A -1713-2,1% 814 m`r -ffq" cicb 3T4err % m't -rtrifr, 0„- t'll'.

.„....•

Pf3rith 34TR- * q,kUT 495-44) 4 S974 9 6 -if

lbart-T, mc't 6Clqf

cclii qf ffitzr

p

:

1032 RPH Sa.Vidhaika_Data I

LA1'4' '710 •CA-- -.;-.--nlr"-;6' • • - - 1—

image19.tif

_ anoxéfieim Em NS. Ewgwgfigé E.gfifir5%5wwmfivfimw¢umwgfi ”.ENEWEE‘EFanEEMEuE HELEEEEEBE ywfifiwwfiflwfifirwufivgfiflg. EEEwEEEEwEa 3 I5 Ea fig EEKVEE ‘om finsmmmwm 5. fix Em WEN W WE» Eh... .35pr E E E Em w ,. IfiErmwfiflrflflsEEFmEE ESE wgmrmmgfiflwfiazgflfifiégfiwwfiflgfl Imm Ewgcfica 88 fig 3 M? E E Em . . ; ON .Imm Efiwwfi” ~

TraTT 31-CRITITTI quId. 28 WWI, 2009 21

40— (i) fl *HON fth—fil Ted91-4 MA VcM, 111:MTO, alMar arra-A gi-Tr ftbr .friTti arfeficr4 * wraw.T. cbeir A 4 arrtsr A fflitz 7E7. tO 3S1 i5 g. •Ar& trftftry, 7frit4 AT 414 wr 4 M. ft7t 34T4Vti-45 i ti4Wk wi1 sm4 0,1 : -- tA

Si*-1T * f4Ar-i 41 44 4

-flArfkrS trviA i $b 41 fiw wOrr vgAr-A (-0 S3T4A laud- Tri waft autuu filN iuf * *19-4 i 3Tigf Win w4AT vgy.A3T (i)* 31111A fit awkA tR -gitucitr A mfr 3IT4R wi aiitifi A-M.4 wrz1-41 ft Aqvuu (1) A Thitz 14491-r 9t 2if 3TP-T4T 'TWA 7 cfrmr 3Teara ri /1 I

srd cnroft , APT A Agivt i 44 gio 4,1c1 ITRIT n kmcil t 1 3-4, .P1

A arqacCi-4 344S$ f5 1-191.4 cfq Urftr TruftAr ftfri ardifu aT341 tb-R-M 4174 t amA 3TEA4A 4ucti -4A- j1 iat tuf•tict; I 1M.1 7Tur 4,14 far114,..iidu 91,9 t, FRTiy arfit trr tur4 liTtIT 3.1 alargA aritel m4 *)1=4 qiel al-1W *fir'r7 awit -AT

3Tc2R1- 30 3*i4 3T7fATA writ 4 ‘fill q-r xkl& ard74 faAtia f4,41r Itzfr tfj,Jrcw Ft:4T Thief A Fitg1,3, 34-4-4741 fazardweie tcI tutrAr 714 ftTflt

aTITOt 4Thi th—Mit. aiarr7A 4A. * gigr 1 /43—icr 7-ar ttj -A4-$T 4.A7A-ei4

cisi1P1 likVf 31741-1:51Tift 9zaraciicitl ft/1W, 2009 7: TeAf4u f ti

augr vART cromcnbr,

No: 493(2)/LJOUX-V-1-09- I (ka)9-2009 Dated Lucicnow, February 28, 2009

In pursuance of the provisions of clause (3) of Article 348 of the Constitution, the Governor is pleased, to order the publication of the following • english translation of the Uttar Pradesh Arbi Farsi Vishwavidyalaya Adhiniyam, 2009 (Uttar Pradesh Adhiniyam Sankhya 12 of 2009) as passed by the Uttar Pradesh Legislature and assented by the Governor on February 27, 2009.

THE UTTAR PRADESH ARABI PHARSI UNIVERSITY

ACT, 2009

(1.1.P. Act no. 12 of 2009)

[As passed by Uttar Pradesh Legislature]

ACT

' To provide for the eltablishment of an Arabi-Pharsi University at Lucknow in Uttar Pradesh for teaching and research in Urdu Arabi and Pharsi languages and to provide for matters connected therewith .ohincidental. thereto.

ET IS HEREBY enacted in the Sixteeth year of the RePublit of India as follows :—

CHAPTER-I

PRELIMINARY

I. (1.) This Act may be called the Uttar Pradesh ARABI PHARSI UNIVERSITY ACT, 2009

- (2) It shall come into force on, such date as the State Government may, by notification in the Gazette, appoint.

(?)

(.3)

5 0ft title„ ° nloPecmcnt

32 RPH Sa.Vidhaikafiata I

image20.tif

3313331331313311332811333 2009 ' 21 “51333111333333 40—,(1) 31331333333333.33333333333313331 311331m2131333133331333311313111133333331 .‘ . 33313333113313f3fi131221331333m-fi3m1 “-3 ' 1333333333313313333211333333313333 '“‘ 33333333333333 91111333: . '93“ ”mm-"*- '- 1113 31,1 31131321113 1113131 1:13 3 1m 3} 21 erg 2,1,», ' W$WW3§333133133131331 “’3' (21'3qu (1)3333321111311133311331331311311333 -’ . " 3331133311wa11313ravnl , (3)33113110331331331131133131333313311333m ... , .3333131133.3fi313313m(1)3fif3133133r‘ ‘- 33333333333333333313333331 33331133313111 .. 331333333133333113313333313131333333133 13333133331131 33333333333333133333133331333331133131313331311-1313331‘11 31333333333333333133133333331313331333331313133333133433 mammmWfimawwmmfimmmm3ma3mfi 3333333333333333333333333333333331333331333331331 'fiswmm1133wfiwm3—mfiwfi3m3mafimmfim1 33313331133333313313133333333333333331333333333333331 311121133131 3333133313333113—3331333331321133113, 200933: 13113313313331 31131 3, "' 1 ‘ . v 31321 | No: 493(2)/LXXIX-V-1-09-1(ka)9-2009 Dated Lucknow. February 28, 2009 l 1 __ 1‘ In pursuance of the provis1ons of clause (3) of Anicle 348 of the Constitution, the Governor is pleased to order the publication of the following- english Kranslauon of the Uttar Pradesh Arbi larsi 5 Vishwavidyalaya Adhimyam 2009 (Ullar Pradesh Adhiniyam Sankhya 12 of 2009) as passed by the Ullar Pradesh Legislature and asscmed by the Governor on February 27 2009. THE UTTAR PRADESH ARABI PHARSI UNIVERSI FY Am, 2009 1' , . ‘ . (U11. Act no. 12 012009) [As passéd by Ullar Pradesh Legislamre] ' ' ' 'AN ACT T 0 provide for the establishment of an ArabI-Pham Universny a1 Lucknow in Uttar Pradesh for “Ching and rexearch in Urdu Arabz and Pharsi languages and 10 provide for matters connected therewith , nc1den1a1-1hereto. CHAPTER-I 1W! 1. (1.) This Act may be called the Uttar Pradesh ARAB] PHARSI UNIV]: RS]' 1 Y ACT, 2009_ 1 (2) 11 shall come -imo force on. such date as the Slate Govemmcnl may, by notification in the Gazette, appoint.

; 4th

22 STP( WAi %Mx-tit-Mut .tut LO 4..QUJ

2. In this Act, unless the context otherwise requires:-

'Academic Council', 'Court' and 'Executive Council' mean respectively

the Academic Council, the Court and the Executive Council of nit ;

University; 'affiliated college' means an institution affiliated to the University th , ) accordance with the provisions of this Act or the Statutes of the university;

'associated college' means any institution recognised by the University;

'faculty' means a faculty of the University;

'hall' (or college) of the University means a unit of residence for students, maintained or recognised by the University at which provision is made for imparting tutorial and other supplementary instructions;

'hostel' of • the University, means a unit of residence for studentS maintained or recognized by the University, other than hall, and hostel of ‘ an affiliated or associated college means a unit of residence for students of ,

that college; 'prescribed' means prescribed by the statutes;

'principal', in relation to an affiliated, associated or a. constituent college,

means the head of such college ;

'registered graduate' means a graduate of the University; ,

'statutes', 'ordinances' and 'regulations' means respectively the statutes',

ordinances and regulations of the University; '

(II) 'teacher' means a person employed in the University or in an institute oi-'..

in a constituent, affiliated or associated college of the University;

(12) 'university' means the Uttar Pradesh ARABI- PHARSI UNIVERSITY',

established under section 3.

CHAPTER-II

THE UNIVERSITY

3.. (1) There shall be established at Lucknow in Uttar Pradesh by the name of the Uttar Pradesh Arabi Pharsi University.

The University shall be body corporate: The object of the university shall be to provide advance knowledge and wisdom and understanding by teaching and research of Urdu. Arbi and Pharsi languages to

the scholars. The University shall be open to all persons irrespective of class or creed, but nothing in this section shall be deemed to require the University to admit to course of study a larger number of students than may be determined by the

ordinances: Provided that nothing in this section shall be deemed to prevent t1I8

University from making special provisions for admission of studenls belonging to the Scheduled Castes, the Scheduled Tribes or other backward classes

,

of citizen. The University shall have the following powers and duties, namely -

to provide for instructions in such branches of learning as the Universil$: may think fit, and to make provision for research and for' the advancement'

and dissemination of knowledge; ,

to admit any college to the privileges of affiliation or recognition antht0. guide and control the work of affiliated and associated colleges; to institute degrees, diplomas and other academic distinctions;

to hold examination for granting and confering degrees, diplomas

other academic distinctions to and on persons who-

have pursued, a course of study in the University. a constituent collagn or an affiliated college. or associated college; or have carried on research in' the University or in an institutio

n

1032 RPH Sa.Vidhaiku Data 1

Definitions

Establishment and incorporation of the University

Object of the University

University open to all classes and creed

Pnwr and duties of the University

(2)

(I)

10 1

image21.tif

skit HQ?! omtqu ‘IutL, La «win. we; i, ‘ Definitions 2. In this Act, unless the context otherwise requires:- (1) 'Aeademie Council'. ‘Court’ and ‘Executive Council' mean respectively, the Academic Council. the Court and the Executive Council of 1H“ University; " 7T (2) 'affiliated college' means an institution affiliated to the University E,“ , , , accordance with the provisions of this Act or the Statutes of the university;) ' ‘x‘ (3) ‘associated college means any institution recognised by the University; . (4) 'faculty' means a faculty of the University; _1 (5) 'Itall' (or college) of the University means a unit of residence for Student; u maintained or recognised by the University at which provision is made fer l . imparting tutorial and other supplementary instructions: \ ‘ .' ; (6) 'ltostcl' of ‘the University, means a unit of residence for Studcms' M ! : maintained or recognized by the University‘ other than hall, and hostel of , t _ an affiliated or associated college means a unit of residence for students of “ 1 that college: . . (7) 'prescribed' means prescribed by the statutes; t i {I . i (8) ‘prineipal'. in relation to an affiliated, associated or a. constituent college] a; L means the head of such college ; . : , (9) 'registcred graduate' means a graduate ofthe University; ‘1‘?“ ‘ t 4 (10) 'statutes‘, 'ordinancos‘ and 'regulations' means respectively the statutesV ‘ fl . ordinances and regulations of the University; ' '3' ‘ t”: I (l 1) 'teacher' means a person employed in the University or in an institute 0%: ’ i' in a constituent, affiliated or associated college of the University; 1 t . ' . (12) 'university' means the Uttar Pradesh ARABI- PIIARSI UNIVERSITY; ' . ! i established under section 3. I i ‘. l CHAPTER-II ; 1 THE UNIVERSITY _ -' ; .it; > ‘ ESXIF‘HSWWHII 3, (I) There shall be established at Lucknow in Uttar Pradesh by the name of the - ‘ _ :2'l'1'3i3‘31'2i'3’" Uttar Pradesh Arabi Pharsi University. * f . ' (2) The University shall be body corporate: .: ‘I 0%“quth 4. The object of the university shall be to provide advance knowledge and wisdorti' u ' ‘- 't un'vm‘w ‘ and understanding by teaching and research of Urdui Arbi and Pharsi languages to, _ .l ' the scholars. i Univmi‘y Wm” 5. The University shall be open to all persons irrespective of class or creed, bill I “masses “‘1 “Md nothing in this section shall be deemed to require the University to admit to an) ' course of study a larger number of students than may be determined by the ordinances: Provided that nothing in this section shall be deemed to prevent tile University from making special provisions for admission of smdénts belonging to the Scheduled Castes, the Scheduled Tribes or other backward clasSCS' 1 . of citizent : ”BMW? dUtiCS "r 6. The University shall have the following powers and duties. namely — , . v the University ‘ ; I “- (l) to provide for instructions in such branches of learning as the Universi‘Yr may think fit. and to make provision for research and for' the advanccmtfmf and dissemination ofknowledgc; ti . . (2) to admit any college to the pnvtlcges of affiliation or recognition anstO. _ ‘ ' guide and control the work of affiliated and associated colleges; “ 1‘ , (3) to institute degrees, diplomas and other academic distinctions; (4) to hold examination for granting and confering degrees, diploma other academic distinctions to and on persons who- I . ~. (a) have pursued, a course of study in the University. a constituent 60““?- ‘ . s and . or an affiliated college. or associated college: or t u (b) have carried on research in' the University or in an instllu“° l032 RPH Sa.Vidlt:tikuuData |

314.<1 Olt1It4IX.1 'WM, a tir(Ci, 2UU9 23

recognised in that behalf by the University or independently, under conditions laid down in the statutes and the ordinances; or

(c) have pursued a course of study by correspondence whether residing within the area of the University or not. and have been registered by the University, Subject to such conditions as may be laid down in the statutes and Ordinances as external candidates; or

(d). are teachers orothet employees in the University or in an Institute or in a constituent or affiliated or associated college or in any other educational institutions under conditions laid down in the statutes and the ordinances or are inspecting officers permanently employed in the Department of Education of the State Government, are eligible and have carried on private studies under conditions laid down in the' statutes and the ordinances; or

( e) are women and are.eligible and have carried on private studies under conditions laid dchln in the statutes and ordinances; or .

(0

are blind and are eligible and have carried on private studies under cimelitions laid dowin in the.statutes and the ordinances:

to hold .examinations for and to grant the degree of the University to the persons under conditions .laid down in the .statutes and the ordinances.

(6) to confer honorary degree or other academic distinction in the manner and under conditions laid down in the statutes:

(7). to grant such diplomas to and to provide such lectures and instructions, for persons, not being students of the University, as the University may determine;

to co-operate or collaborate with other Universities and authorities in such manner and for suet] puiposes as the University may determine;

tO institute leaching posts reqUired .by the University and to appoint persons to such post.

to recognize teachers for giving instruction in halls;

to lay down the conditions of affiliation or recognition of colleges and to satisfy itself by periodical inspection and otherwise that those conditions are satisfied;

to institute and award scholarships, fellowships (including traveling fellowship), studentships and prizes in accordance with the statutes and the ordinances;

to institute and maintain halls and hostels and lo recognize places of residence for students of the University, the Institutes or the constituent or associated colleges affiliated; or

to demand and receive such fees. and other charges as maybe fixed by the ordinances;

to supervise and control the residence and to. regulate the discipline of students of the University, the Institute and the constituent or affiliated or associated colleges and to make arrangements for promoting their health:

to create administrative,, ministerial and other necessary posts and to make appointments thereto: and

to do all such acts and things, whether incidental to the powers aforesaid or not as may be required in order to' further the objects of the University.

CHAPTER-III

OFFICERS OF THE UNIVERSITY Officer of thc 7. The following shall be the officers of the University;

University

(a) the Chancellor

1032 RN-I Sa.Vidhaika_Data I

(5)

image22.tif

mm mm omirmvi mac, as mom, 2009 23 1 recognised in that behalf by the University or independently, under . conditions laid down 1n the statutes and the ordinances; or (e) have pursued a course of study by correspondence whether residing within the area of the University or not. and have been registered by the University, subject to such conditions as may be laid down in the statutes and Ordinances as external candidates; or (d) are teachers or'other employees in the University or in an Institute or in a constituent or affiliated or associated college or in any other i- " ., educational institutions under conditions laid down in the statutes 1 1 , and the ordinances or are inspecting officers permanently employed in the Department of Education of the State Government are eligible and have carried on private studies under conditions laid down in the statutes and the ordinances; or .. 1" 1 ( e) are women and are eligible and have carried on private studies under conditions laid down in the statutes and ordinances; or . _ V (f) are blind and are eligible and have carried on private studies under «’ . ' conditions laid down in the statutes and the ordinances: ' (5) to hold examinations for and to grant the degree of the University to the persons under conditions laid down in the .statutes and the ordinances. » ,- (6) to confer honorary degree or other academic distinction in the manner and under conditions laid down in the statutes: _ (7). to grant such diplomas to and to provide such lectures and instructions for 1. I . persons not being students of the University as the University may ' determine; ‘ (8) to co~operate or collaborate with other Universities and authorities in such i i ' ' ' _ manner and for such purposes as the University may determine; ' . ' ‘ ' (9) to institute leaching posts required by the University and to appoint persons . to such post ‘ ” (10) to recognize teachers for giving instruction in halls; r. (1 l) to lay down the conditions of affiliation or recognition of colleges and to satisfy itself by periodical inspection and otherwise that those V . . _ conditions are satisfied; , > (12) to institute and ,award scholarships, fellowships (including traveling . fellowship) studentships and prizes in accordance with the statutes and the if ' ordinances: I (13) to institute and maintain halls and hostels and lo recognize places of residence . " ‘ for students of the University, the lnstitutes or the constituent or associated ' _ colleges affiliated; or i i , -’ I (14) to demand and receive such fees and other charges as may be fixed by the ordinances; (15) to supervise and control the residence and to regulate the discipline of students of the University, the Institute and the constituent or affiliated or associated colleges and to make arrangements for promoting their health: ‘ , V (16) m create administrative, ministerial and other necessary posts and to make appointments thereto and i j. _ (17) to do all such acts and things whether incidental to the powers afomsaid or not as may be required in order to further the objects of the Universitv. CHAPTER- III OFFICERS OF THE UNIVERSITY " 0mm 0‘th 7. The following shall be the officers of the University ; ~- University (a) the Chancellor "’32 KPH SuiVidhaika_Data l

'

I

TIT

24

‘31-K 14 Yr STiilliNtriIluiC 28 1:57ifql, 2009

the Vice Chancellor;

the Finance Officer;

the Registrar; •

the Controller of Examinations;

the Deans of Facilities;

(h) such other officers as may be declared by the Statues to be the officers of the,

University.

The Chancellor 8. (1) The Governor shall be the Chancellor of the University. He shall, by virtue

of his .office, be the Head of the University and the President

of the court and shall, when present, preside at meeting the court and af

any convocation of the University.

Every proposal for the conferment of an honorary degree shall be subject to

the confirmation of the Chancellor.

It shall. be the duty of the Vice-Chancellor to furnish such information or

records relating to the administration of the affairs of the University a the Chancellor may call for.

The Chancellor shall have such other powers as may be conferred on him

by or under this Act or the statutes.

The Vice Chancellor 9. (1) The Vice Chancellor shall be a whole-time salaried officer of the

University and shall be appointed by the Chancellor from amongst the

persons whose names are submitted to him by the committee

constituted. in accordance with the provisions of sub-section (2).

(2) The committee shall consist of the following members, namely :—

One person (not being a person connected with the University, an

Institute, a constituent college, an associated or affiliated college

or a hall or hostel) to be elected by the Executive Council (at

least three months before the date on which a vacancy in the .

office of the Vice-Chancellor is due to occur by reason of expiry.,

of his term);

One person who is or has been a Judge of the High Court Of:

Judicature at Allahabad nominated by the Chief Justice; and

One. person to be nominated by the Chancellor who shall also be

the convener of the committee :

Provided that where the Executive Council fails to elect any person in accordance with clause (a), then the Chancellorr.,

shall nominate in addition to the person nominated by him ,

under clause (c), one person in lieu of the representative of the-

Executive Council.

(3) The comrnittee, shall, as far as may be. at least sixty days before the date on

which a vacancy in the office of the Vice-Chancellor is due to occur 111

reason of expiry-of term or resignation under sub-section (7) and also,

whenever so required and before such date as may be specified by the

Chancellor, submit to the Chancellor the names of not less than thrS

and not more than five persons suitable to hold the office of the Vice

Chancellor. The committee shall, while submitting the names, als°

forward to the Chancellor a concise statement showing the academit

1032 12F11 Sa Vidhaika_Data 1

image23.tif

"924" on? new warm W, 28 watt. 2009 (b) the Vice Chancellor; m (c) the Finance Officer; (d) the Registrar ; - H V (e) the Controller of Examinations; (f) the Deans of Facilities; (h) such other officers as may be declared by the Statues to be the officers 0fth University. ' The Chancellor 8. (1) The Governor shall be the Chancellor of the University. He shall, by virtue“: of his .office,‘ be the Head of the University and the Prcsidcn of the court and shall, when present, preside at meeting the court and at any convocation of the University. > \ (2) Every proposal for the conferrnent of an honorary degree shall be subject to‘ the confirmation of the Chancellor. (3) It shall be the duty of the Vice-Chancellor to furnish such information of. ‘ records relating to the administration of the affairs of the University as the Chancellor may call for. (4) The Chancellor shall have such other powers as may be conferred on him I, by or under this Act or the statutes. ' The Vice Chancellor 9. (1) The Vice Chancellor shall be a whole-time salaried officer of the University and shall be appointed by the Chancellor from amongst the: persons whose names are submitted to him by the committee ' constituted in accordance with the provisions ofsub-section (2). (2) The committee shall consist of the following members, namely :~ (a) One person (not being a person connected with the University, _an' ' Institute, a constituent college, an associated or affiliated college - ' or'a hall or hostel) to be elected by the Executive Council (at ' least three months before the date on which a vacancy in the office ofthe Vice-Chancellor is due to occur by reason ofexpiry‘ of his term); (b) One person who is or has been a Judge of the High Court of ‘. Judicature at Allahabad nominated by the ChiefJustice; and (c) One person to be nominated by the Chancellor who shall also be the convener ofthe committee : ' Provided that where the Executive Council fails lo elcCE, any person in accordance with clause (a), then the Chancellor,. shall nominate in addition to the person nominated by him under clause (e), one person in lieu of the representative of’ thew Executive Council. (3) The committee, shall, as far as may be. at least sixty days before the date 0 g which a vacancy in the office of the Vice-Chancellor is due to occur W -' i (t reason of expiry—of term or resignation under sub—section (7) and also; 1 whenever so required and before such date as may be specified by (he, ’ Chancellor. submit to the Chancellor the names of not less than the and not more than five persons suitable to hold the office of the V1"c Chancellor. The committee shall, while submitting the names, Bis," forward to the Chancellor a concise statement showing the academ‘, 1032 RPH Sa Vidhaika_Data l

qualifications and other distinctions of each of the persons 'so

recommended, but shall not indicate, any order of preference. •

Where the Chancellor does not consider any on or more of persons

recommended by the Committee to be suitable for appointment as Vice-

Chancellor or if one or more of the persons recommended is or are not

available for appointment and the choice of the Chancellor is restricted

to less than three persons, he may require the Committee to submit a list of fresh names in accordance with sub-section (3).

If the Committee in the case referred to in sub-section (3) or sub-section

(4) fails or is unable to suggest any names within the time specified by

the Chancellor, or if the Chancellor does not consider any one or more

of the fresh names recommended by the Committee to be suitable for

appointment, as Vice-Chancellor another Committee consisting of three

persons of academic eminence shall be constituted by the Chancellor

which shall submit the names in accordance with sub-section (3).

No act or proceeding .of the committee shall be invalidated merely by

reason of the existence of a vacancy or vacancies among its members or

by reason of some person having taken pan in the proceedings who is subsequently found not to have been entitled to do so.

(a) Only such persans shall be eligible for apointment to the office of

Vice-Chancellor who has not attained the age of sixty five years;

the Vice-Chancellor shall hold office for a term of three years from the date on which he enters upon his office or till he attains the age of sixty eight years whichever is earlier;

The Vice-Chancellor who has not attained the age of sixty fore years may be appointed as such for second Terms:

Provided that the Vice-Chancellor may by writing under his hand

addressed to the Chancellor resign, his office, and shall cease to hold his

office on the acceptance by the Chancellor of such resignation.

(8). Subject to the provisions of this Act, the emoluments and other conditions

of service of the Vice-Chancellor shall be such as may be

determined by the State Government by general or special order in that behalf.

The Vice-Chancellor shall not be entitled to the benefit of any pension.

insurance 'or provident fund constituted under section 33 of the State University Act. 1973: •

Provided that when any teacher or other employee of any

University or any affiliated or associate college is appointed as Vice-

Chancellor, he shall be allowed to continue to contribute to the

provident fund to which he is a subscriber and the contribution of the

University shall be limited to what it had been contributing immediately before his appointment as Vice-Chancellor.

In any of the following cireumstances (of the existence of which the

Chancellor shall be the sole judge), the Chancellor may appoint any

suitable person to the office of Vice-Chancellor for a term not exceeding six months as he may specify :—

(a) Where a vacancy 'in the office of Vice-Chancellor occurs or is

likely to occur by reason of leave or any other cause, not being

resignation or expiry of term of which a report shall forthwith be made by the Registrar to the Chancellor;

1032 RPA Sa.Vidhailca_Data I

image24.tif

,Iv Ion ttPH Sa.Vidhaikn_Data I qualifications and other distinctions of each of the persons '50 recommended, but shall not indicate, any order ofprefcrence. (4) Where the Chancellor does not consider any on- or more of persons recommended by the Committee to be suitable for appointment as Vice- Chancellor or if one or more of the persons recomrncrtdcd is or are not available for appointment and the choice of the Chancellor is restricted to less thatt three persons. he may require the Committee to subtnit a list of fresh names in accordance with sub-section (3). (5) If the Committee in the case referred to in sub-section (3) or sub-section (4) fails or is unable to suggest any names within the time specified by the Chancellor, or if the Chancellor does not consider any one or more of the fresh names recommended by the Committee to be suitable for appointment, as Vice-Chancellor another Committee consisting of three persons of academic eminettee shall be constituted by the Chancellor which shall submit the names in accordance with sub-section (3). (6) No act or proceedingof the committee shall be invalidated merely by reason of the existence of a vacancy or vacancies among its members or by reason of some person having taken pan in the proceedings who is subsequently found not to have been entitled to do so. (7) (a) Only such persans shall be eligible for apointment to the office of Vice-Chancellor who has not attaitted the age ofsixty five years; (b) The Vice-Chancellor shall hold office for a term of three years from the date on which he enters upon his office or till he attains the age of sixty eight years whichever is earlier; (c) The Vice-Chancellor who has not attained the age of sixty fore years may be appointed as such for second Temts: Provided that the Vice-Chancellor may by writing under his hand addressed to the Chancellor resign, his office. and shall cease to hold his office on the acceptance by the Chancellor of such resignation) (8). Subject to the provisions ofthis Act, the emoluments and other conditions of service of the Vice-Chancellor shall be such as may be determined by the State Government by general or special order in that behalf ‘ (9) The Vice-Chancellor shall not be entitled to the benefit of any pension, insurance or provident fund constituted under section 33 of the State University Act. 1973: - Provided that when any teacher or other employee of any University or any affiliated or associate college is appointed as Vice- Chancellor, he shall be allowed to continue to contribute to the provident fund to which he is a subscriber and the contribution of the' University shall be limited to what it had been contributing immediately before his appointment as Vice-Chancellor. (10) In any of the following circumstances (of the existence of which the Chancellor shall be the sole judge), the Chancellor may appoint any suitable person to the office of Vice-Chancellor for a term not exceeding six months as he may specify 2— ' (a) Where a vacancy 'in the office of Vice-Chancellor occurs or is likely to occur by reason of leave or any other cause, not being resignation or expiry of term of which a report shall forthwith be made by the Registrar to the Chancellor;

Prin-71( I.

I 313:1111Ru1 livid. 28 1:Mt. 2009

4..

Powers and duties of the Officers

Authorities of the University

Constitution of the Executive Council,

Where a vacancy in the office of Vice-Chancellor occurs and i

cannot be. conveniently and expeditiously filled in accordance

with the provisions of sub-sections (1) to (5);

Any other emergency:

Provided that the Chancellor may. from time to time

extend, the term of appointment of any person to the

office of the Vice-Chancellor under this sub-section, so

however, that the total term of such appointment including:

the term fixed in the original order does not exceed one year.

(II) Until a Vice-Chancellor appointed under sub-section (1) or sub-section (5y,K.

or sub-section (10) assumes office, the senior most Professor of the

University shall discharge the duties of the Vice-Chancellor as well.

If in the opinion of the Chancellor, the Vice-Chancellor willfully omits or

refuses to carry out the provisions 'of this Act or abuses the powers .

vested in him, or if it otherwise appears to the Chancellor that the 4

continuance of the Vice-Chancellor 'in office is detrimental to the

interest of the University, the Chancellor may after making such inquiry

as he deems proper, by order, remove the Vice-Chancellor.

During the pendency, or in contemplation, of any inquiry referred to in

sub-i.e.:nu .1 (12) the Chancellor may order that till further orders

(a)

Such Vice-Chancellor shall refrain from performing the functions

of the office of Vice-Chancellor, but shall continue to get the ,

emoluments to which he was otherwise entitled under sub-

section (8);

(h) The functions of the office of the Vice-Chancellor shall be '

performed by the person specified in the order.

10 The powers and duties of the Finance Officer, the Registrar, the Controller of

Examination, the Deans of Faculties and other officers of the University shall.

be such as may be prescribed.

CHAPTER-IV

AUTHORITIES OF THE UNIVERSITY

The following shall be the authorities of the University:

the Executive Council ;

the Court;

the Academic Council ;

the Finance Committee;

the Faculties ;

the Admissions Committee;

the Examination Committee ;r. 1

such other authorities as may be declared by the Statues to be authorities of

the University.

(1) The Executive Council shall consist of:—

The Vice-Chancellor, who shall be the Chairman thereof;

The Deans of two Faculties by rotation in the manner as prescribed/

by the statues of the University.

1032 RPH Sa.Vidhaika_Data I

image25.tif

Powers and duties of IO The powers and duties of the Finance Officer, the Registrar, the Controller of" i f the Officers Authorities ofthc University Constitution of the Executive Council. 1032 RPH SalvidhaiktLData | am ne’er W m, 28 we, 2009 cannot becom'eniently and expeditiously filled in “ccnrdanoc , with the provisions ofsub-sections (l) to (5); (c) Any other emergency: Provided that the Chancellor may. from time to lime, . x extend, the term of appointment of any person to their office of the Vice-Chancellor uttder this sub—section. 50,, however. that the total term of such appointment including; the term fixed in the original order does not exceed one year, t . (l 1) Until a ViccAChanccllor appointed under sub-section (1) or sub-section (5)} or sub-section (l0) assumes office, the senior tnost Professor of ”to University shall discharge the duties of the Vice—Chancellor as well. . (l2) lfin the opinion ofthe Chancellor, the Vice-Chancellor willfully omits 0r} ‘ refuses to carry out the provisions‘of this Act or abuses the powers: vested in hint, or if it otherwise appears to the Cltancellor that the continuance of the Vice-Chancellor'in office is detrimental to the \ ‘. interest of the University, the Chancellor may after making such inquiry; as he deems pmper. by order, remove the Vice-Chancellor. ' (13) During the pendency, or in contemplation, of any inquiry referred to in g. sub—:teetit 't ( l 2) the Chancellor may order that till further orders :— f (a) Such V ice-Chancellor shall refrain from performing the functions of the office of Vice‘Chaneellor, but shall continue to get the i. emoluments to which he was otherwise entitled under sub i L section (8); ‘ , (b) The functions of the office of the Vice—Chancellor shall be -‘ performed by the person specified in the order. Examination, the Deans of Faculties and other officers of the University shall-1 be such as may beprescribed I CHAPTER-IV AUTHORITIES OF THE UNIVERSITY The following shall be the authorities of the University : i *1 ti 3 the Executive Council ; the Court; the Academic Council ; the Finance Committee; _ } the Faculties ; the Admissions Committee ; the Examination Committee a n 1 such other authorities as may be declared by the Statues to be authorities of - , the University, ' (l) The Executive Council shall consist of :- (a) The Vice-Chancellor, wlto shall be the Chairman thereof: i (b) The Deans of two Faculties by rotation in the manner as prescribfidJ , by the statues of the University.

Powefsond dillies of Executive Council

\nu gbr 3MMTRUT Rri , 28 97&t1, 2009 27 .

(2) (a) Two Professors [other than a Dean referred to in clause (b) of sub- section (1) two Readers and two Lecturers of the University, to be selected in such manner as may be prescribed:

(b) One Principal of an affiliated college to be selected in such manner as may be prescribed.

Four persons to be elected by members of the Court from amongst such of them as • are not enrolled as students of or in the service of the University or an Institute or of a constituent college or an affiliated or associated college or hall or •li• )stel.

(4) (a) Four persons of academic eminence to be nominated by the Chancellor;

(b) One person, from amongst the reputed industrialists who have made valuable contribution in the field of higher education to be nominated by the State Government:

„Provided that one of the persons to be nominated under this .-sub-section shall be a person who is or has been a Judge of the

Supreme Court or High Court.

The term of office of members shall be such as specified in the statutes and ordinances of the University. •

No person shall be a member of the Executive Council for more than two consecutive terms. •

Notwitlislanding anything contained in any other provision of this Act, no person shall be elected or nominated as a member of the Executive Council unless he is a graduate.

A pers- on shall be disqualified for being chosen as and for being, a . member of the Executive Council if he or his relative accepts any remuneration for any work in or for the University or any contract for the supply of goods- to or for the execution of any work for the University:

Provided that nothing in this sub-section shall apply to the acceptance of any remuneration by a teacher as such or for any duties performed in connection with an examination conducted by the University or for any duties as Superintendent or Warden of a training unit or any hall or hostel or proctor or tutor for any duties of a similar nature in relation to the University.

Explanation :— In this section 'relative' means the relations defined in section 6 of the Companies Act, 1956 and. includes the wife's (or husband's) brother, wife's (or husband's) father, wife's (or husband's) sister, brother's son and brother's daughter.

13 . (1) The Executive Council shall be the principal executive body of the University and subject to the provisions of this Act have the f011owing powers, namely -

to hold and control the property and funds of the University;

to acquire or transfer any movable or immovable property on behalf of the University;

to make, amend or repeal Statutes and Ordinances;

to administer any funds placed at the • disposal of the University for specific purposes,.

to prepare the budget of the University;

(3)

(5)

9idhailth_Daut I

image26.tif

Pawn-is and duties of Executive Council ,13. an? m mm were. 28 was). 2009 ' 27 . (2) (a) Two Professors [other than a Dean referred to in clause (b) of sub- section (1) two Readers and two Lecturers of the University, to be selected in such manner as may be prescribed: (b) One Principal of an affiliated college to be selected in such manner as may be prescribed. (3) Four persons to be elected by members of the Court from amongst such of them as- are not enrolled as students of or in the service of the‘ University or an Institute or of a constituent college or an affiliated or associated college or hall or it lSlCi (4) (a) Four persons of academic eminence to be nominated by the Chancellor; (b) One person, from amongst the reputed industrialists who have made ' valuable contribution in the field of higher education to be nominated by the. State Government : Provided that one of the persons to be nominated under this 'sub section shall be a person who is or has been a Judge of the Supreme Court or High Court (5) The term of office of members shall be such as specified in the statutes and ordinances of the University (6) No person shall be a member of the Executive Council for more than two consecutive terms (7) Notwithstanding anything contained In any other provision of this Act no person shall be elected or nominated as a member of the Executive Council unless he 15 a graduate (8) A person shall be disqualified for being chosen as and for being, a member=of the Executive Council if he or his relative accepts any remuneration for any work in or for the University or any contract for the supply of goods' to or for the execution of any work for the University: Provided that nething in this sub- section shall apply to the acceptance of any remuneration by a teacher as such or for any duties performed in connection with an examination conducted by the University or for any duties as Supenntendent or Warden of a training unit or any hall or hostel or proctor or tutor for any duties of a similar nature in relation to the University. Explanation :— In this section 'relative' means the relations defined in section 6 of the Companies Act 1956 and. includes the wife's (or husbands) brother wifes (or husband's) father, wife's (or husband‘s) sister brother’ 5 son and brother's daughter. (1) The Executive Council shall be the principal executive body of the University and subject to the provisions of this Act have the following powers, namely- ' (i) to hold and control the property and funds of the University; (ii) to acquire or transfer any movable or immovable property on‘ behalf of the University; (iii) to make, amend or repeal Statutes and Ordinances ; (iv) to administer any funds plaee'd at = the‘ disposal of the University for specific purposes; ‘ (v) to prepare the budget of the University;

1032 RPH Sa.Vidhaikapata 1

c3te1:c CA01. citilluixot 'I V1L. 40 , ,,• t .4,

(VI) to award scholarship. fi:Ilowships, bursaries, medals and othe

rewards in accordance iisith the Statutes and Ordinances:

to appoint offic::o.i. :eachers and other employees of the

University and to define their duties and the conditions of

their servi,:e, to provide for the filling of temporary

casual vacancies in their posts

to fix the fees, emoluments and travelling and other allowances '

of the examiners;

to admit any college to the privileges of affiliation or recognition;

to arrange for and direct the inspection of Institutes, affiliated,

associated or constituent colleges. halls, hostels and other

places of residence of students ;

to direct the form and use of the common seal of the University;

to regulate and enforce discipline among members of the

teaching, administrative and other staff of the University in

accordance with the Statutes and the Ordinances ; •

to manage and regulate the finances, accounts, investments,

property, business and all other administrative affairs of the

University, and for that purpose, to appoint such agents as it

may think fit;

to invest any money belonging to the University:

to provide the buildings, premises, furniture and apparatus and

other means needed for carrying on the work of the

University;

to enter into, vary, carry out and cancel contracts on behalf of the

University;

to regulate and determine all other matters concerning the

University as well as Institutes, constituent, affiliated and

associated colleges in accordance with this Act the Statutes

and the Ordinances.

(2) No immovable property of the University shall, except with the prior

sanction of the State Government, be transferred (except by way of

letting from month to month in the ordinary course of management) by . C:

the Executive Council by way of mortgage, sale, exchange, gift or

otherwise nor shall any money be borrowed, or advance taken on the

security thereof except as a condition of receipt of any grant-in-aid of the'

University from the State Government, or with the previous sanction of.

the State Government, from any other person.

(3) No expenditure in respect of which approval of the State Government is 4 .

required by this Act or di, ‘i mattes or Ordinances shall be incurred

except with such approval previously obtained, and no post shall he )

created either in the University or in any Institute or constituent colldge 4

maintained by the University except with the prior approval of the Staic

Government or except in accordance with any general or special order of

the State Government. (4) The Executive Council may, with the prior approval of the University

Grants Commission and the State Government create supernumer arY

post of teacher of the University with a view to enabling a teache .1

Who is for the time being holding a responsible position of nation -f"

image27.tif

~- l032 RPH Sa.Vidhaika_Data l BTW __—_____.__._—- (2) No immovable property of the University 5 (3) No expenditure in resp '__._’————_~ (Mtllulxvt ‘IUIC‘ Ln mm t A" s, bursaries, medals and other it; (vi) to award scholarshipr fellowship d Ordinances: rewards in accordance With the Statutes an (vii) to appoint otficrvs. teachers and other employees of the ;; Universny and to define their duties and the conditions of ‘., their Service: A to provide for the filling of temporary ‘u casual vaezutcies in their posts 1 (viii) to fix the fees, emoluments and travelling and other allowanceS t, of the examiners; (ix) to admit any college to the privileges of affiliation or rccognitiom a . . . t- on ot Institutes, affiliated .t ‘ J ,.' (x) to arrange for and direct the inspecti halls, hostels and other i” associated or constituent colleges. places of residence of students ; (xi) to direct the form and use of the common seal of the University; (xii) to regulate and enforce discipline among members of the 1 teaching, administrative and other staff of the University in accordance with the Statutes and the Ordinances ;. vestrncnts, (xiii) to manage and regulate the finances. accounts, in dministrative affairs of the t: , A' " l», l property, business and all other a University. and for that purpose, to appoin may think fit; {_ (xiv) to invest any money belonging to the University; t such agents as it 3' ses, furniture and apparatus and “f " 5 (xv) to provide the buildings. premi other means needed for carrying University; on the work of the! (xvi) to enter into: vary, carry out and cancel contracts on behalf of the . University; J matters concerning the . ‘ onstituent, affiliated and: h this Act the Statutes (xvii) to regulate and determine all other University as well as lnstitutes, c associated colleges in accordance wit and the Ordinances hall, except with the prior sanction of the State Government, be transferred (except by way of 1 letting from month to month-in the ordinary course of management) by. the Executive Council by way of mortgage, sale, exchange, gift of}, otherwise nor shall any money be borrowed. or advance taken on the ‘_ security thereof except as a condition of receipt of any grant-in—aid of thcj‘ University front the State G ' ction of" ovemment, or with the previous san the State Government, from any other person. 7, ect of which approval ol‘the State Government 151 > hall be incurred ‘- ‘s’tntutes or.Ordinances s required by this Act or tht a except with such approval previously obtained, and no post shall 1191‘ ‘ i created either in the University or in any Institute or constituent collcgc maintained by the University except with the prior approval of the 5m” f ‘ . Government or except in accordance with any general or special 0rd?r 0‘ - 'l the State Government, (4) The Executive Council may, with the prior approval of the Uni Grants Commission and the State Government create supemu post of teacher of the University with a view to enabling a who is for the time being holding a responsible position of n8 verSilX merm’. teaCh?‘. 7 tionll! I

.1

The Court

importance in India or abroad in educational administration or other similar assignments, to retain his lion; arid seniority as such teacher and also to continue to earn increments in his pay scale during the period of his assignment and to contribute towards provident fund and earn retirement benefits, if any. in accordance with the Statutes:

Provided that no salary shall be payable to such teacher by the

University for the period of such assignment.

The pay and other allowances to various categories of the employees of the University Or of any Institute or constituent college or affiliated or associated college shall be 'such as may be approved by the State Government.

The Executive Council shall not exceed the limits of recurring and non- recurring expenditure to be incurred in each financial year fixed by the Finance Committee.

The Executive Council shall not take any action in regard to the number, qualifications and emoluments of teachers, and. the fees payable to examiners, except after considering the advice of the Academic Council and the Boards of Faculties concerned.

The Executive Council shall give due consideration to every resblution of the COurt, and take such action thereon as it shall deem fit and report to the Court, the action taken or, as the case may be, the reasons for non- acceptance of the resolution.

The Eiecutive Council may subject to any conditions laid down in the Statutes, delegate such of its powers as it deems fit to an officer or any other authority of the University, or to a Committee appointed by it.

14. (1) The Court shall consist of the following members, namely:—

Class I- Ex-Officio Members

the Chancellor who shall be the Chairperson;

the members of the Executive Council;

.(iii) the Finance Officer;

Class II- Life Members,

in the case of an existing University, every person who was a life member of the Corm or Senate immediately before the commencement of this Act;

Class-Ill- Representatives of teachers, etc.

all heads of departments of The University and of constituent, colleges maintained by it;

two representatives of provosts and wardens of hostels and halls of the University and of its constituent colleges and Institutes to be selected by rotation in such manner as may be prescribed;

fifteen teachers ,to be selected in such manner as may be prescribed;

two representatives of the managements of the affiliated or associated colleges to be selected by rotation in such manner as may be prescribed:

Class-IV -Registered Graduates

fifteen representatives of registered graduates to be elected, by registered graduates of such standing as may be prescribed from .

1,032,11PH Se.Vidhaika_Data I

image28.tif

1! i_ u' \ r.‘ importance in India or abroad in educational administration or other similar assignments, to retain his lion and seniority as such teacher and also to continue to earn increments in his pay scale during the period ofhis assignment and to contribute towards provideni fund and earn retirement benefits. if any. in accordance with the Statutes: Proyided that no salary shall be payable to such teacher by the University for the period of such assignment. (5) The pay and other allowances to various categories of the employees of the University or of any Institute or constituent college or affiliated or associated college shall be such as may be approved by the State Government . (6) The Executive Council shall not exceed the limits of recurring and non— recun'ing expenditure to be incurred in each financial year fixed by the Finance Committee. _ . (7) The Executive Council shall not take any action in regard to the number, qualifications and emoluments of teachers, and. the fees payable to examiners, except after considering the advice of the Academic Council and the Boards of Faculties concerned. V " (8) The Executive Council shall give due considei-ation to every resolution of the Court. and take such action thereon as it shall deem fit and report to the Court, the action taken or, as the case may be, the reasons for non- acceptance of the resolution. ' (9) The EXecutive Council may subject to any conditions laid down in the Statutes, delegate such of its powers as it deems fit to an officer or any other authority of the University, or to a Committee appointed by it, 14. (l) The Court shall consist of the following members, namely :— Class I- Ex-Oflicio Members (i) the Chancellor who shall be the Chairperson; (ii) the members of the Executive Council; (in) the Finance Officer; Class [1- Life Members, (iv) in the case of an existing University, every person who was a life member of the Court or Senate immediately before the commencement of this Act; Class-III- Representatives afreachers, etc. (v) all heads' of departments of the University and of constituent, colleges maintained by it; (vi) two representafives of provosts and wardens of hostels and halls of the University and of its constituent colleges and Institutes to be selected by rotation in such manner as may be prescribed; (vii) fifteen teachers ,to be selected in such manner as may be prescribed; * (viii) two representatives of the managements of the affiliated or associated colleges to be selected by rotation in such manner as may be prescribed: , Class-l V -Regislere(l Graduates (ix) fifteen representatives of registered graduates to be elected. by registered graduates of such standing as may be prescribed from [032 RPH Sa,Vidhaika_Dala l

Powers and duties of the Court

Meeting of the Court

Academic Council

CM,

iv tItic ntrci stntiptiot-

a. amongst such of them as are not in the service of the University.

or of an Institute or of a constituent college or in the service °!'

connected with the management of affiliated college. associateTd,

college, hall or hostel;

Class-V- Representation of Students •

one student from each of the Faculties, who having secured tie highest marks in that Faculty at the preceding degr'ett,

examination of the University shall pursue a course of study 1'0[7 a postgraduate degree in the University.

Class-VI- Representatives of the State Legislature

two members of the Legislative Council to be elected by it;

(xii)five members of the Legislative Assembly to be elected by it.'

(2) The term of office, of members of each class, except Classes I. II arid V,

mentioned in sub-section (1) shall be three years and the term of dire

--members of the said class V shall be one year.

15. The Court shall be an advisory body subject to the provisions of this Act,"

shall have the following powers and functions, namely:—

(a) to review, from time to time, the broad policies and programmea

of the University and to suggest measures for the improvemcni • ,

and development of University;

(b) to consider and pass resolutions on the annual report the annual

accounts of the University and the audit report thereon:

(c) to advise the Chancellor in respect of any matter which may

referred to it foradvice; and ;s.

(d) to perform such other duties and exercise such other functions as. may be aisigned to. it by this Act or the Statutes or by the

Chancellor.

16. (1) The Court .shall-meet once a year on a date to be fixed. by the Vice

Chancellqr and such meeting shall be called the annual meeting of ilia

Court.

(2) The, Vice-Chanaellor may, whenever he thinks fit and shall, upon;!

requisition in writing-signed by not less than -one-fourth of the toad

member of the Court, convene a special meeting of the Court.

17. (1) The Academic Council shall be the principal academic body of 111c

University and subject to the provisions of this Act the Statutes and tab

Ordinances -

shall have the control and general regulation of, and be responsibb 0 for the maintenance of standard of instruction, education ant

research carried on or imparted in the University;

may advise the Executive Council on all academic matt0 •

including matteis5relating to examinations conducted by rite

University; and

shall have such powers and duties as may be conferred or impos

upon it by the Statutes.

(2) The Academic Council stall consist of the following members, namely7

the Vice-Chancellor who shall be the Chairperson;

the Deans of all Faculties; 10

1032 RPH Sa.Vidhaikapata 1

image29.tif

JV \au‘ >1~<<1vn11~uv1 um», Lu 1I\-1\I, “NI "5 ‘1 ‘ 1 :- amongst such of them as are not in the service of the Univmh; i . or of an Institute or ofa constituent college or in the Service‘ or . 5 l ' connected with the management of affiliated college assoqamfl l 1 i l ‘ college, hall or hostel; ‘ Class- V- Representation of Students - ’ it“ l ‘ ' ' (x) one student from each of the Faculties who having secured the W . highest marks in that Faculty at the preceding degrac . ' examination of the University shall pursue a course of study for a postgraduate degree in the University. , . i " l' l: . . ' , _ Class- VI- Representatives of the State Legislature (xi) two members of the Legislative Council to be elected by it ; (xii)five members ofthe LegislativetAssembly to be elected by it. ‘ .‘t l1 (2) The term of office of members of each class, except Classes l. [I and VI ‘ mentioned in sub— section (1) shall be three years and the term of the members of the said class V shall be one year Powers and duties of 15_ _ The Court shall be an advisory body subject to the provisions of this ACL'ii . g ‘hc CW“ ' shall have the following powers and functions, namely2— ‘ ‘ A (a) to review, from time to time, the broad policies and programme; '1 of the University and to suggest measures for the improvemml , 1’ and development of the University , - (b) to consider and pass resolutions on the annual report the annual ' i _ accounts of the University and the audit report thereon: ' l 1 . l ‘ ' i (c) to advise the Chancellor in respect of any matter which may 3%,- referred to it for‘advice; and ' (d) to perform such other dutie’s” and exercise such other functions as may be assigned to'it by this Act or the Statutes or by the' Chancellor ‘ - M'W‘ing 0W“: CW“ 16. (l) The Court shall- meet once a year on a date to be fixed _by the Vice Chancellor and such meeting shall be called the annual meeting of the: - " ‘ Court. (2) The Vice-Chancellor may, whenever he thinks fit and shall upon :11 requisition in writing- signed by not less than one- -fourth of the toiiil' ‘ ‘, member of the Court, convene a special meeting of the Court. ‘ Acfldmic Council 17. (l) The Academic Council shall be the principal academic body of the . ' University and subject to the provisions of this Act the Statutes and lit? ‘ Ordinances - ‘ " (a) shall have the control and general regulation of and be responsiblb for the maintenance of standard of instruction, education anti' 1' rescarch carried on or imparted 1n the University; ‘ ‘ (b) may advise the Executive Council on all academic mad“? l ‘1 including matteis 5relating to examinations conducted by '| University; and ' (c) shall have such powers and duties as may be conferred or 1mP°5 . 1 l upon it by the Statutes. pg l (2) The Academic Council stall consist of the following members namClY ‘1 ' l ,, 1 0 (i) the Vice-Chancellor who shall be the Chairperson: , . ‘ (ii) the Deans of all Faculties ; 1032 RPH Sa.Vidhaika_Da11i 1

The Finance

Committee

all Heads of Departments of the University;

all Professors of the University wit are not Heads of Departments;

.(v) the Principals of constituent colleges and the Directors,of Institutes;

two Professors. frdin each constituent college, if any by iotation'in order of seniority to be determined in the manner pres4ibed;

three Principals of affiliated or associated colleges to be selected bY rotation in the manner Prescribed.;

fifteen leachers to be selected in the inanrier prescribed;

the•Librarian of the University; and .

five persons of academic eminence to be co-dpted in the manner prescribed.

(3) The term of office' of members other than a-officio members shall be such as may be prescribed.- •

18. (1) The'Finance Committee shall consist of-

the Vice-Chancellor who shall be the Chairperson;

the Secretary to the State ' Government in Welfare & Waqf Department.

the Secretary to The State Government in Department;

the Registrar;

(b) the Controller of Examinations;

(f). one person, not being a member of the Executive Council or tile

Acidehic COuncil or a paSon in the service of the University or an •

Institute or of a constituent college, or a member of the Managing

Conimitted of any affiliated or associated college, or a person in the

service of Such college, to be elected by the Executive Council;-'and

the Finance Officer who shall also be the 'Secretary of 'the Conunittee.

(2) A member referred to in clause (b) or clause (c) of sub-section (I ).!nay,

inatead of attending any meeting of the Finance • Committee himself,

depute an officer not below the rank of a Joint. Secretary to the State Government arid- an officer so deputed shall also have the right to vote.

.(3) The Pinance.Co'mmipee, shall advise the ExecutiVc Council on matters relating. to the administration of property and hinds of the University. It .Shall, having regard to the income and resourees of the University' , fix 'Mins • for the toful recurring and non,curring-eipenditurd for the ensuing financial year and may, for any SPecial reasons, revise during the financial year the limits of expenditure so fixed and the limits so fixed shall be binding on the Executive Council.

The Finance Committee shall have such .other powers and duties as may

be conferred or imposed on it by this Act or the Statutes.

Unless a proposal hailing 'financial implication has-been retommended

by the Finance Committee, the Executive Council shall • not take a decision -thereon, and if the Executive Council disagrees with the

&commendations of the Finance Committee, it shall refer. MeiCtriposal back to-the Finance ComnThitteet with reasons for the disagreement and if.

the Minority

the Finance

(g)

1032 RPH SaNidhaika Data I

image30.tif

' w ’ (iii) all Heads of Departments of the University; ‘4 (iv)- all Professors of the University who are not Heads of Departments; ”(v) the Principals of constituent colleges and the Directorsvof Institutes; t ,> (vi) two Professors: from each constituent college, if any by ‘rotatiOn’in ; E; 1 ' order of seniority to be determined 1n the manner prescribed; (vii) three Principals of afi‘ hated or associated colleges to be selected by rotation in the manner prescribed; 1 (viii) fifteen. teachers to be selected in the manner prescribed; j” . (ix) the Librarian of the University; and _ . (x) five persons of academic eminence to be co- opted in the manner 3 prescribed. ‘ (3) The term of office' of members other than ex-afl‘ C10 members shall be such as may be prescribed The Finance: 18. ( l) The Finance Committee shall consist of- Committcc ' ~ " - (a) the Vice- Chancellor who shall be the Chairperson; (b) the Secretary to the State Government in the Minority Welfare & Waqf Department. (c) the Secretary to .the State Government in the Finance Department; ' (d) the Registrar; i ' _ . If (e) the Controllerof Examinations; (O‘one person, not being a member of the Executive Council or the 'Acade'riiic council or a person in the service of the University or an ‘ _ Institute or of a constituent college, or a member of the Managing Vt Committee of any affiliated or associated college, or a person in the service of Such college, to be elected by the Executive Council; 'and (g) the Finance Officer who shall also be the Secretary of the 1 . Comniitiee. . V (2) A member refemed to in clause (b) or clause (c) of sub- section (I) may _ instead of attending any meeting of the Finance Committee himself, , . 1 deptite an officer not below the rank of a Joint. Secretary to the State a. 1 Goverrunent 'and an officer so deputed shall also have the right to vote. ~(3) The Finance Committee, shall advise the Executive Council on matters relating to the administration of property and funds of the University. It . shall having regard to the mcome and resources of the University, fix limits for the total récumng and non ycumng expenditure for the ensuing financial year and may, for any special reasons revise during the financial year the limits of expenditure so fixed and the limits so fixed shall be binding on the Executive Council. \ (4) The Finance Committee shall have such other powers and duties as may be conferred or imposed on it by this Act or the Statutes. (5) Unless a proposal having ‘financial implication has.been recommended by the Finance Committee: the Executive Council shall‘not take a decision thereon and if the Executive Council disagrees with the r’eeommendutions of the Finance Committee it shall refer the pioposul back to the Finance Committee with reasons for the disagreement and ii

the Executive Council again disagrees with the recommendation of the

Finance Committee the matter shall be referred to the Chancellor whose

decision thereon shall be final.

The University shall have such Faculties as may be prescribed

Each Faculty shall comprise such departments of teaching as may be prescribed and each department shall have such subjects of study as may

be assigned to it by the Ordinances.

There shall be a Board of each Faculty, the constitution (including the term of office of its members) and powers and duties of which shall be

such as may be prescribed.

There shall be a Dean of each Faculty who shall be chosen from amongst the Professors by rotation in order of seniority and shall hold office for

three years.

The Dean shall be the Chairman of the Board of Faculty and be

responsible for -

the organization and conduct of the teaching and researoh work

of departments comprised in the Faculty; and

the due observance of the Statues. Ordinances and Regulations

relating to the Faculty.

In each Department of teaching in the University, there shall be a Head.

of the.Department whose appointment shall be regulated by Statues.

The Head of Department shall be responsible to the Dean for the organization of teaching in the department and have such other powers

and duties as may be provided in the Ordinances.

There shall be constituted in accordance with the provisions of the Ordinances, Boards of Studies in respect of different subjects of , study and more than one subject may be assigned to one Board of •

Studies.

There shall be an Admissions Committee of the University, the

,

constitution of which shall be such as may be laid down in the , '

Ordinances.

(2) ffhe. Admissions Committee shall have the power to appoirit such number

of sub-committees as it thinIci fit.

(3) Subject to the superintendence of the Academic Council, the Admissions

Committee shall lay down the Principles or, !barns governing the policy

of admission not Carious courSes of studies in the University and may

also nominate a person or a sub-committee as, the admitting authority in

respect of any course of study in an Institute or a constituent college'

maintained by the University.

(4) No student admitted to any college in contravention of the provisions of

this section shall. be permitted to lake up any examination conducted.bY

the University, and the Vice-Chancellor shall have the power to cancel

any admission made in such contravention.

,• The Faculties 19. (I)

11

' ;

;j.

The AdmissiOns. 20. (1) Committee

the the 21.

(1) There' shall be an Examination Committee in the University, constitution of which shall be such as may be laid down in

Ordinances.

(2) The Examination Committee shall, supervise generally all examinations of the University, including moderation and tabulation, and perform t11

following other functions, namely - •

The Examinations

Committee

1032 FtPH Sa.Vidhaika_Data 1

image31.tif

Jt‘ Tlic Faculties The Admissions. Committee "me Examinations Committee 1032 RPH Sa.Vidhaika_Datal . g . v\t\ r1~<\1ui\n-ht. ”01,.“ .. . i.., -... the Executive Council again disagrees with the recommendation of the‘ Finance Committee the matter shall be referred to the Chancellor Whose. ‘i decision thereon shall be final. Hg. 19. (l) The University shall have such Faculties as may be prescribed (2) Each Faculty shall comprise such departments of teaching as may be ‘i ‘ prescribed and each department shall have such subjects of study as may be assigned to it by the Ordinances. 1 (3) There shall be a Board of each Faculty, the constitution (including the term of office of its members) and powers and duties of which shall be if i such as may be prescribed. ‘ (4) There shall be a Dean of each Faculty who shall be chosen from amongst -,' the Professors by rotation in order of seniority and shall hold office for , three years. (5) The Dean shall be the Chairman of the Board of Faculty and he ~ responsible for — . (a) the organization and conduct of the teaching and research work . i of departments comprised in the Faculty ; and ' (b) the due observance of the Statues. Ordinances and Regulations relating to the Faculty ‘ (6) in each Department ofteaching in the University, there shall be al-Iead' t of therDcpartment whose appointment shall be regulated by Statues. ' (7) The Head of Department shall be responsible to the Dean for the organization of teaching in the department and have such other powers \ and duties as may be provided in the Ordinances. ' (8) There shall be constituted in accordance with the provisions of that .A\ Ordinances, Boards of Studies in respect of different subjects of study and more than one subject may be assigned to one Board of- Studies. ,. . . ,_ 20. (1) There shall be an Admissions Committee of the University, the constitution’ of which shall be such as may be laid down in the 5’ Ordinances. _ .. (2) The Admissions Committee shall have the power to appoint such number ‘ of sub-committees as it thinks fit. (3) Subject to the superintendenee of the Academic Council, the Admissions Committee shall lay down the Principles or, loams governing the policy of admission not various courses of studies in the University and may also nominate a person or a subcommittee as the admitting authonty in I i respect of any course of study in an Institute or a constituent college‘ i‘ maintained by the Uriiversity. (4) No student admitted to any college' 1n contravention of the provisions of this section shall be permitted to lake up any examination conducted by the University, and the Vice- Chancellor shall have the power to cancel any admission made in such contravention. 2]. (1)_ There" shall be an Examination Committee in the University- constitution of which shall be such as may be laid down in the‘ Ordinances. (2) The Examination Committee shall supervise generally all examinations i of the University, including moderation and tabulation and perform ‘11 following other functions, namely -. 1 {ia' ' rev-t . ..«*

Others Authorities

Appointment of Teachers

'irN Lti affiltiRul 'Md. 28 M-701. 2009 33

(a) to appoint examiners and moderators and, if necessary, to

remove them;

.(b) to review from time to time . the results of University

examinations and submission of reports thereon to the

Academic Council :

to make recommendations to the Academic Council for the

improvement of the examination system ;

to scrutinize the list of examiners proposed by the Board of

Studies, finalise the same and declare the result of the

examination of the University.

The Examinations Committee may appoint such . number of

subcommittees as it thinks fit, and in particular may delegate to any

one .or more persons or sub-committees the power to deal with and

decide cases relating to the use of unfair means by the examinees.

Notwithstanding anything contained in any other provision of this Act,

it shall be lawful for an Examinations Committee or, as the case may

be, for. a sub-committee or any person to whom the Examinations

Committee has delegated its power in this behalf under sub-section

(1), to debar an examinee from future examinations: of the

University. if in its or his opinion, such examinee is guilty of using •

unfair means at any such examination.

The constitution powers and duties of other authorities of the University shall .

be such as May be prescribed.

CHAPTER-V

APPOINTMENT AND CONDITIONS'OF SERVICE OF TEACHERS AND OTHER EMPLOYEES OF THE UNIVERSITY

The appointment of the teachers and other employees of the University and the

terms and conditions of service shall be such as may be prescribed.

CHAPTER-VI AFFILIATION

'Affiliation of Colleges

24. (I) This section shall apply to the colleges.

The Executive Council may, with the preVious sanction of the

, Chancellor, admit any college which fulfils such conditions of

affiliations, as may be prescribed to the privileges of affiliation or

enlarge the privileges of any college already affiliated or withdraw .

or curtail any-such privilege.

'It shall be lawful for a college to make arrangement with any other

college situated in the same local area, or with the University, for

co-operation in the work of teaching or research.

Excepts as provided by this Act, the management Of a c011egb shall

be free to manage 'and control the affairs of the college and be

responsible for its maintenande and up keep, and its Principal shall

be responsible for the discipline of its students and for the

superintendence and control over its staff.

(51 Every College shall furnish such reports, returns and other particulars

as the Executive Council or the Vice Chancellor may call for.

(C) The Executive Council shall cause every college to be inspected from

time to time at intervals not exceeding five years by one or more persons

authorised by it in that behalf, and a report of the inspection shall be

1032 RPH Sa.Vidhailta_Data I

image32.tif

__ _ __ . - am new mam nae, 28 mail. 2009 33 a - ‘/____—__—~___.__—__ ‘(a) to appoint examiners and moderators and, if necessary, to . “i remove them; i lb) to review from time to time . the results of University examinations and submission of reports thereon to the Academic Council 1 _-, (c) to make recommendations to the Academic Council for the I . 1 - improvement ofthe examination system ; (d) to scrutinize the list of examiners proposed by the Board of, ,. A“ 1 Studies, finalise the same and declare the result of the =§ i . " , . examination of the University . (3) The Examinations Committee may appoint such , number of . _ .. subcommittees as it thinks fit. and in particular may delegate to any « j | one -or more persons or subcommittees the power to deal with and i decide cases relating to the use ofunfair means by the examinees. (4) Notwithstanding anything contained in any other provision of this Act. . ‘ E . ‘ it shall be lawful for an Examinations Committee or, as the case may' t , be, for. a sub-committee or any person to whom the Examinations “ Committee has delegated its power in this behalf under sub-section ; . . (3) to debar an examinee from future examinations: of the i i . University if 1n its or his opinion, such examince is guilty of using ll. . unfair means at any such examination a. - Others Auihmilics 22. The constitution powers and duties of other authorities of the University shall , be such as may be prescribed 7 -, ’ . CHAPTER-V APPOINTMENT AND CONDITIONS'OF SERVICE OF TEACHERS AND OTHER ....;~;: 23”} ENIPLOYEES OF THE UNIVERSITY g V‘ . Appoinlmcm 01‘ 23. The appointment of the teachers and other employees of the University and the _‘ '7’ ; , Tmhm ' terrns and conditions of service shall be such as may be prescribed. E in ' ' _ l, . ~ CHAPTER v1 _ AF F {LIA I' ION Afl‘llialion OTCOHCSCS 24. (1) This section shall apply to the colleges i (2) The Executive Council may, with the previous sanction of the i ' ,Chaneellor. admit any college which fulfils such conditions of affiliations as may be prescribed to the privileges of affiliation or enlarge the privileges of any college already affiliated or Withdraw _ or curtail any such privilege (3) “It shall be lawful for acollege to make arrangement with any other . . ' college situated in the same local area, or with the University, for co-operation in the work of teaching or research. ‘ - ('4) Excepts as provided by this Act, the management of a college shall be free to manage and control the affairs of the college and be responsible for its maintenance and up keep. and its Principal shall be responsible for the discipline of its students and for the superintendenee and control over its staff. (51 i i Every College shall fiimish such reports returns and other paniculars . -‘ . as the Executive Council or the Vice Chancellor may call for 1y . I - 3(6‘) The Executive Council shall cause every college to be inspected from ' ' time to time at intervals not exceeding five years by one or more persons authorised by it in that behalf, and a report of the inspection shall be

III

Disqualification for

Membership of

Management

Inspection and Inquiry

made to the Executive Council.

The Executive Council may direct a college so inspected to take such

action as may appear to it to be necessary within such periods as may be

specified.

The privileges of affiliation of a college which fails to comply with any

direction of the Executive Council under sub-section (7) or to fulfill, the

conditions of affiliation may. after obtaining a report from the

Management of the college and with the previous sanction of the

Chancellor. be withdrawn or curtailed by the Executive Council in

accordance with the provisions of the Regulations.

Notwithstanding anything contained in sub-sections (2) and (8) if the

Management of any college has failed to fulfil the conditions of

affiliation, the Chancellor may after obtaining a report from the

Management and the, Vice-Chancellor, withdraw or curtail the

privileges of affiliation

A person shall be disqualified for being chosen as, and for being a member of -

the Management of a college (other than a college) maintained exclusively by

the Slate Government or by local authority), if he or his relative accepts any

remuneration for any Work in or for such college or any contract for the

supply of goods to, or for the ex -cution of and work for such college.

(!) The State Government shall have the right to cause an inspection to be

made by such person as it may direct, of any college, including its

buildings laboratories and equipments thereof and also of the

examination, teaching and other work conducted or done by it, or cause

an inquiry to he made in respect of any matter connected with the

administration, and finances of such college.

Where the State Government decides to cause an inspection or inquiry to

be made under sub-section (1). it shall inform the Management of the

collage and a representative appointed by the Management and where'

the Management fails to appoint a representative, the Principle of the

college may be present at such inspection or inquiry and shall have the

right to be heard on behalf of the Management .but no legal practitioner

shall appear, plead or act on behalf of the college at such inspection or

inquiry.

The person or persons appointed to inspect or inquiry under sub-section

(1) shall have all the powers of a civil court while trying a suit under the

Code of the Civil Procedure. 190S for the purpose of taking evidence on

oath and of enforcing the attendance of witnesses and 'compelling

production of documents and material objects. and shall be deemed to

be. a Civil Court within the meaning of sections 345 and 346 of the code

of criminal procedure 1973 and an}' proceeding before him or them

shall be deemed to be judicial proceedings within the meaning of

section 193 and 228 of the ii...ian Penal Code.

(4). The State Government may communicate to the Management of the

college, the result of such inspection or inquiry :Intl ma% issue direction

as to the action lo be taken and the Management Thrill fortwith comply

with :arch direction.

(5) The State Government shall inform the Vice-Chancellor about the

communication made by it to the Management under subsection (4)

and the Vice-Chancellor shall communicate to the Executive Council tel

1032 RPH Sa Vidhaika_Data I

image33.tif

made to the Executive Council. 1 ; (7) The Executive Council ntay direct a college so inspected to take such action as may appear to it to be necessary within such periods as may be specified. direction ofthe Executive Council under sub-section (7) or to fulfill. the d. ‘ . conditions of affiliation may. after obtaining a report from the I ' Management of the college and with the previous sanction of the '-, l '- (8) The privileges of affiliation ofa college which fails to comply with any I r q ,5 Chancellor. be withdrawn or curtailed by the Executive Council in 1' ‘3' accordance with the provisions ofthc Regulations. 1 ‘3, (9) Notwithstanding anything contained in subsections (2) and (8) if the 2; I Management of any college has failed to fulfil the conditions of I) affiliation, the Chancellor may after obtaining a rcpon from the .3 " Management and the, Vice-Chancellor. withdraw or curtail the privileges of affiliation Disqunlificfllion f0" 25. A person shall be disqualified for being chosen as, and for being a member of - ," h. L m::fi::::t°r the Management ofa college (other than a college) maintained exclusively by i ‘r‘ the Slate Government or by local authority), ifhe or his relative accepts any 9 ’ remuneration for atty Work in or for such college or any contract for the ; supply ofgoods to, or for the. ex ’cution of and work for such college. lnSPW‘ionfind Inquiry 26. (l) The State Govemntcnt sha‘ai have the right to cause an inspection to be made'by such person as it may direct, of any college, including its buildings laboratories and equipments thereof and also of the examination, teaching and other work conducted or done by it, or cause an inquiry to be made in reSpect of any matter connected with the administration, and finances of such college. (2) Where the State Govemmcnt decides to cause an inspection or inquiry to , i 9 be made under sub-section (1). it shall inform the Management of the i . collage and a representative appointed by the Management and where' ‘ the Management fails to appoint a representative, the Principle of the college may be present at such inspection or inquiry and shall have the right to be heard on behalf of the Manag'emcntlbut no legal practitioner shall appear. plead or act on behalf of the college at such inspection or inquiry. ‘ (3) The person or persons appointed to inspect or inquiry under sub-section i l ; (1) shall have all the powers ofa civil coun while trying a suit under the Code ofthe Civil Procedure. 1908 for the purpose oftaking evidence on oath and of enforcing the attendance of witnesses and compelling production of documents and material objects, and shall be deemed to it , bea Civil Court within the meaning of sections 345 and 346 ofthc code '- ' ' of criminal procedure 1973 and an)‘ proceeding before him or them i ’ i . shall be deemed to be judicial proceedings within the meaning of section 193 and 228 of the ii...ian Penal Code. '\ (4). The State Govemment may communicate to the Management of the college, the result of such inspection or inquiry and mm issue direction as to the action 10 be taken and the Management shall {outwith comply . ' . With such direction. I . . , (5) The State Government shall tnfomt the Vice-Chancellor about the . . i 3 i 1 communication made by it to the Management under subsection (4) . ' and the ViceCh'an'cellor shall communicate to the Executive Council . |032 KPH Sn,VidIIaika_Data l

Dar on cibiri:r.; orany

donation etc. for

admission to a college

•• • • • .441 'I• cuv, . .5)

Government may offer upon the action to be taken thereon. the views, of the State Government with such advice as the State

The Vice-Chancellor shall then within such time as the State Government may fix, submit to a .report of the action taken or proposed to be taken by (the Executive Council.

If the University authorites do not, within a reasonable time, take action to the, satisfaction of the State Government, the State Government may, after considering an explanation which 'the University authorities may furnish, issue such directions as it may

think fit, and the University authorities shall be bound to comply with such directions.

The State Government may at any time, call for any information from

the Management or Principal of college in connection with such inspection, or inquiry.

27. No person connected with the Management of a college and no principal or

other teacher or employee thereof shall directly or indirectly take or receive or

cause 10 be taken or received any contribution, donation fees or any other

payment of any sort, either in cash or in kind, except the fees at the rates laid

down in the RcRolations from or on behalf of any pupil as a condition for

granting him admission to or permitting him after such admission to continue in such college.

CHAPTER-VII.

Stmuics how made

Statutes and Ordinances

28. (1) The First Statutes of the University shall be made by the State Government by notification.

(2) The Executive Council may, from time to time, make new or additional Statutes or may amend or repeal the statutes referred to in sub-section (0:

Provided that the Executive Council shall not, make, amend • or repeal any statutes affecting the status, power or constitution of any authority of the University until such authority. has been given a . reasonable opportunity to express its opinion in: writing on the proposed changes and any opinion so expressed has been conaidered by the Executive Council.

(1) Notwithstanding anything contained in, the foregoing sub-sections, the State Government may in order to implement any dedision taken by it in the interest of learning, teaching or research on the basis of any suggestion or recommendation of the University Grants Commission . or the State or National .Education Policy require the Executive Council to make new or additional statutes of amend .or repeal the statutes referred to M sub-section (1) or sub-section (2) within a, , specified, time and if the Executive Council fails, to comply With such requirement the Stale Government may make new or additional statues amend or repeal the statutes referred to in sub-section (1) or sub section (2).

(4) Subject to the other provisions of this Act the status may provide for any matters relatini to the University and shall in particular, provide . for

(a) the appointment, powers and duties of the officers .of the University;

O321tp Sa.Vidhaika_Data I

image34.tif

. ...e, 5.“ www, LUV) .5) the views, of the State Government with such advice as the State Government may offer upon the action to be taken thereon. 5 . .3. , (6) The Vice—Chancellor shall then within such time as the State it ‘ . Government may fix, submit to a report of the action taken or I'd-i : ‘. ‘ . _ proposed to be taken by (the Executive Council. 1 , b . . i i‘ (7) If the University authorites do not, within a reasonable time, take action to the. satisfaction of the State Government, the State . . Govemment may. after considering an explanation which 'the - f i ; University authorities may furnish, issue such directions as it may , think fit. and the University authorities shall be bound to comply with i ' ' such directions. ' ' i ‘ (8) The State Government may at any time, call for any information from the Management or Principal of college in connection with such inspection- or inquiry. ‘ V main" vim-“aw; vl'any 27. No person connected with the Management ofa college and no principal or "“"a‘m" ”‘c' f” other teacher or employee thereofshall directly or indirectly take or receive or “Fmi-“ionmacuncge cause 10 be taken or received any contribution, donation fees or any other payment of any sort, either in cash or in kind, except the fees at the rates laid a: 3 down in the Regulations from or on behalf of any pupil as a condition for ' * ‘ ' - granting him aduussien to or permitting him after such admission to continue 1‘ ‘ in such college. i “x' CHAPTER-VII . K. _ ‘f' Statutes and Ordinances .. Slatuifihowtnfldf 28. (l) The. First Statutes of the University shall be made by the State J i I H ' Govcmment by notification. ‘ 1 (2) The Executive Council may, from time to time. make new or additional . '9’ ' ‘ Statutes or may amend or repeal the statutes referred to in sub-section ‘. ‘ ' (I): ' . ‘ Provided that the Executive Council shall not, make, amend or repeal any statutes affecting the status, power or constitution of any authority of the University until such authority-hasbeen given a reasonable opportunity to express its opinion in" writing on the proposed changes_and any opinion so expressed has been considered by the Executive Council. _ , , (3) Notwithstanding anything contained in, the foregoing sub¥sections, the ». State Govemment may in order to implement any decision taken by it . , . in the interest of learning. teaching or research on the basis of any suggestion or recommendation of the University Grants Comrriission or the State or National .Education Policy require the Executive Council to make new or additional statutes or‘ ame‘nd-or repeal the > t - statutes referred to in sub-section (1) or sub-section (2) within a " I“ ‘ ‘ » . specified. time and if the Executive Council fails, to comply with such‘ -. _ requirement the Stale Government may make new or additional statues I ' ' amend or repeal the statutes referred to in sub-section (1) or sub section (2). . -.. (4) Subject to the .other provisions of this Act the status may provide for any matters relating to the University and shali in particular, provide . i i for _' . .. (a) the appointment. powers and duties of the officers .of th gt . University ; .~ " . ”323m Sa.Vidhaika_Datul

Power to make Ordinances

'it AtiT 31311k/Rvi quit, 28 WT. 2009

the constitution of Pension or Provident Fund and establishment of an insurance scheme for the benefit or officers and other employees of the University;

the conferment of honorary degrees ;

the withdrawi of degrees and other academic distinctions;

the conditions under which colleges may be admitted to privilei

of affiliation by the University and the conditions under Which any such privilege may be withdrawn;

the degrees and other academic distinctions to be awarded by the University, the qualifications for the same and the amounts to

taken relating to the granting and obtaining of the: same:

the fees to be chargcu for courses of the study in the Universit

and for admission to the examination, degrees and other acadcm

distinctions of the University ;

the conditions of the award of fellowships, scholarship

studentships, medals and prizes;

the conduct of examinations including terms of office and mem

of appointment and duties of examining bodies, examiners

moderators ;

the power to remove officers (excluding Chancellor) an

employees of the University and their emoluments and terms an

conditions of service;

.(k) all other matters which by this Act are to be or may be provid

for by the Regulations.

29. Subject to the provisions of this Act and the Statutes, the Ordinance shall be mad

by Executive Council which may provide for all or any the following mat

namely

(0

(0

(a) the admission of students to the University and their enrolment such;

(b) the courses of study to be laid down for all degrees, diplomas

certificates of the University; •

(c) the medium of instruction and examination.:

. (d) the award of degrees, diplomas, certificates and other acadenua . 11

distinctions, the qualifications for the same and the means to I ba,

taken relating to the granting and obtaining of the same ; 4

(e) the fees to be charged for courses of study in the University an

for admission to the examinations, degrees, diplomas

certificates of the University;

(0 the conditions for the award •of fellowships, scholarsIn

studentships, medals and prizes;

the conduct of examinations, including the term of office

manner of appointment and the duties of examining b

examiners and moderators ;

the conditions of residence of the students of the University ;

the special arrangements, if any, Which may be-made fo

residence, discipline and teaching of women students and

1032 RPH Sa.Vidhaika_Data 1

image35.tif

\ u “WWT 36 am new W m , 28 wet). 2009 l , . (b) the constitution of Pension or Provident Fund and “i , i . . " , establishment of an insurance scheme for the benefit of Hi i . - , , ,t. l‘» , officers and other employees ofthe Universny ; ' . ‘ t (c) the cont‘ennem of honorary degrees ; (d) the withdrawi oi'dcgrecs and other academic distinctions; T ; , (e) the conditions under which colleges may be admitted to privileé“ of affiliation by the University and the conditions under Which i any such privilege may be withdrawn; (f) the degrees and other academic distinctions to be awarded by.th University, the qualifications for the same and the amounts to ,, i taken relating to the granting and obtaining ofthe: same; , i, (g) the fees to be chargcu for courses of the study in the Universn and for admission to the examination, degrees and other acadcnir ‘ distinctions of the University ; I i (h) the conditions of the award of fellowships, scholarships studentships, medals and prizes; I of appointment and duties of examining bodies, examiners am, | (i) the conduct of examinations including terms of office and manner 1 moderators ; :9. 1r: A ' . . (j) the power to remove officers (excluding Chancellor) ani‘ employees of the University and their emoluments and terms an conditions ofservice; ,(k) all other matters which by this Act are to be or may be provr . for by the Regulations. ' ‘ PM?” make 29. Subject to the provisions ofthis Act and the Statutes, the Ordinance shall be made 051mm“ by Executive Council which may provide for all or any the following matt namely :- I (a) the admission of students to the University and their enrolment = such ; i i (b) the co‘urses of study to be laid down for all degrees, diplomas 311' certificates ofthe University ; (c) the medium ofinstruction and examination: ' (d) the award of degrees, diplomas, certificates and other academic ; distinctions, the qualifications for the same and the means to ' taken relating to the granting and obtaining ofthc same ; 0 (e) the fees to be charged for courses of stody in the Universitytin \ f for admission to the examinations, degrees, diplomas i cenificates of the University; ' ' (f) the conditions for the award -of fellowships; scholarshJ' studentships, medals and prizes; ' (g) the conduct oftexaminations. including the term of '0", - . , n. manner of appointment and the duties of examining 17“ I examiners and moderators ; , . (h) the conditions of residence of the students of the .Universl'EY. I (i) the special arrangements. if any, which may be~rnad€ for . . residence, discipline and teaching of women students “Pd ‘1’ r- $1 ; ‘ _ ' i l032 RPH Sa.Vidhaika_DaIal . _, .l ‘

prescribing of special courses -of studies for them within the University;

the appointment and emoluments of employees other than those

for whom provision has been made in the Statutes ;

the establishment of Centers of Studies. Boards of Studies, Inter- disciplinary Studies, Special Centers, Epccialized Laboratories and other Committees;

(I) the manner of co-operation and collaboration With other

Universities and authorities including learned bodies OT associations ;

L

7. Annual Report

Accounts and Audit

the creation, composition and functions of any other body which

is Considered necessary for improving-the academic life of the University;•

the remuneration to 'be paid to the examiners, moderators, invigilators and tabulators: •

such other terms and conditions of service of teachers and other academic staff as are not prescribed by the Statutes.;

CHAPTER-VIII -

Annual Reports and Accounts

. 30. (1.) The .Annual Report of the University shill be prepared under the direction of the Executive Council whidh shall include, among other matters, the steps taken by the University towards the fulfillment of its objectives.

The annual report soprepared shall be submitted to the Chancellor on or before su'ch date as may be prescribed.

A copy of annual report, prepared under sub-section (1) shall also be •

submitted lo the State Government.

31. (1) The annual accounts and balance sheet of the University shall be prepared under the direction of the Executive Council-and shall, once at least every year, and at intervals of not more than fifteen months, bc audited by the Director", Coca! Fund Accounts, Uttar Pradesh or by such person Or persons as the State Government may authorise in this behalf.

(2) A copy of the annual accounts and the balance sheet together with the audit report thereon Shall be submitted to the state Government along with the observation, if any of the executive council before the thirtieth • of September's every year.

Any observation made by the State .Govemment on the annual accounts shall be brought to the notice of the Executive Council 'and the views of the Executive Council, if any, on such observations shall be submitted, to the State Government.

32. (I) Whenever any complaint is received by the State Government regarding loss, waste or misapplication of any money or property of the University or the State Government on its own thinks fit, it may direct for special audit of the University being done by the. Director, Local Fund Accounts, -Uttar Pradesh or by any officer subordinate to him. On receiving special audit report, the State Government shall issue a notice to the officer of the University on account of whose, negligence

Sa.Vidlunka Data I

image36.tif

w m War we, 28 watt. 2009 37 H prescribing of special courses -of studies for them within the 3 University; 5 (j) the appointment and emoluments of employees other than those M‘ . t _ ‘ . for whom provision has been made in the Statutes ; (k) the establishment of Centers of Studies. Boards of Studies, lnter~ disciplinary Studies, Special Centers, Specialized Laboratories and other Committees ; -‘c ‘ i ' (l) the manner of co-operation and collaboration 'with other ',L 'Universities and authorities ‘ including learned bodies or 3 3,: ‘ associations; 1“ r (m) the creation, composition and functions of any iother body which isconsidered necessary for improving-the academic‘ life of the ' University; ‘ (n) the'remuneration to 'be paid to the examiners, moderators, invigilators and tabulators: ’ ‘ *r" . (0) such other terms and conditions of service of teachers and other ' academic staff as are not prescribed by the Statutes; ,, é ’ y _ CHAPTER-Vill' ‘ . _ I Annual Reports and Accounts *' MHUBIRCW" - 30. (1.) ' The Annual Report of the University shall be prepared under the J ' direction of the Executive Council which shall include among other ' matters, the steps taken by the University towards the fulfillment of its objectives. ‘~ . . ,3 . (2) The annual report ‘50 prepared shall be submitted to the Chancellor on. ' or before su‘ch date as may be prescribed. ' (3) A copy of annual report, prepared under sub—section (1) shall also be submitted lo the State Government Amunmr‘d And“ ' 31. (l) The annual accounts and balance sheet of. the University shall be prepared under the direction of the Executive Council-and shall. once , ' at least every year, and at intervals of not more than fifteen months, be audited by the Director", Eocal Fund Accounts, Uttar Pradesh or by such person or persons as the State Government may authorise in this , behalf. (2) A copy of the annual accounts and the balance sheet together with the audit report thereon shall be submitted to the state Government along with the observation if any of the executive council before the thirtieth - of September‘ 5 every year.’ ‘ - ‘ (3) Any observation made by the State Government on the annual accounts shall be brought to the notice of the Executive Council and v ’ the views of the Executive Council, if any, on such observations shall ' be submitted, to the State Government 1 32. (1) Whenever any complaint is received by the State ’Govennnent 4 ' regarding less, waste or misapplication of any money or property of the University or the State Government on its own thinks (it, it may direct for special audit of the; University being done by the DireCtor, Local Fund AccountspUttar Pradesh or by any officer subordinate to him. . i (2) 0n receiving special audit report, the State Government shall issue. a notice to the officer of the University on account of whose. negligence ‘dhliiktLDatal ' 4' I '1 ' . .1! mums“ «"0" it“?

38 Tra7T 3WR-1179( 'lulc, 28 1:67-441, 2009

or misconduct, the loss, waste or misapplication referred to in sub-

section (1), has occurred, calling upon him to explain his action within•

the time fixed by the State Government in this behalf.

If the State Government is of the opinion that the officer should be heial

responsible for paying the surcharge: determined by .the stat

Government, the surcharges shall be recovered as arrears or in such

other manner as may be directed by the State Government.

CHAPTER-IX

Miscellaneous

Except as expressly provided by this act, or the Regulations; officers of the University and members of authorities of the Univei-sity shall so far as may be; be chosen by methods other than election.

Where a provision is made in this Act or the Statutes for an'y

appointment by rotation or according to seniority or other qualifications the manner of rotation and determination of seniority and other

qualifications shall be such as may be prescribed.

Any casual vacancy among the members, other than ex-officio

members^of any authority'or body of the University shall be filled in the

same manner in which the member whose vacancy is to be filled up was

chtoen, and the person filling the vacancy shall be a member of such

authority or body for the residue of the term for which the person whose

place he fills would have been a member.

A person who is a member of an authority of the University as'e

representativ. e of. another body whether of the University or outside,

shall retain his on such authority for so long as he continues to be the

representative of such body.

36. (I) No act or proceeding, of any authority or body or committee of the

University shall be invalid merely by reason of :-

any vacancy or defect in the constitution thereof. .or.

some person having taken part in the proceedings who was. not

entitled to do soor

. (c) any defect in the election, nomination or appointment of a person

actitig as member thereof, or

(d) any irregularity in the procedure not affecting the merits of the case;

36. The Executive Council may be a two-third majority of the members present and

voting, remove any person from membership of any authority or other body 91

(3)

Manner of appointment of officers and

members of authorities

(1.)

(2)

Filling of causal vacancies'

Proceeding not to be invalidated by vacancy. etc.

Removal from membership of the

.4.. University

Reference to the Chancellor

the University upon the ground that such person has been convicted of,an,

offence which, in the opinion-of the Executive Council, is an offence involving,'

moral turpitude or upon the-ground that he has been guilty of scandalous,

conduct or had behaved in a manner unbecoming of a member of the University!

and may upon the same grounds withdraw from any person any degree :or

certificate conferred or granted by.the University.

37. If any question arises whether any person has been duly elected or appointedfl

iany questions as to the validity of a regulation) is in conformity with this Actor .

and

is entitled to be. member of any authority or other body of the Universityp

whether any decision of any authority or the officer of the University (incluchng

Regulations made thereunder the matted shall be referred to the Chancellor

the decision of the Chancellor [heron shall be final:

Proviiled that no reference under this section shall be made :-

1032 RPM Sa.Vidhaika_Data 1

image37.tif

i l . ,_ ii;- .:i 38 Manner ofnppointlncnl 33_ ol'olliccrs and members of authorities Filling ofcnusal 34. ' vacancies Proceeding not to be 35. invalidated by vacancy. etc. Removal from 36' membership oftlte "x. University \ Reference to the 37‘ Chancellor 1032 KPH Sa.Vidhaika_Data I am new W m, 28m, 2009 or misconduct, the loss, waste or misapplication referred to in Sub. section (I), has occurred, calling upon him to explain his action Wilhin J t- the time fixed by the State Govemment in this behalf. L, (3) Ifthe State Government is ofthe opinion that the officer should be held responsible for paying the surcharge: determined by .thc Stat , Government, the surcharges shall be recovered as arrears or in Such A other manner as may be directed by the State Government. CHAPTER-IX .11» Miscellaneous ‘ Except as expressly provided by this act or the Regulatiom officers of the University and members of authorities of thc Univeisity ‘ shall so far as may be; be chosen by methods other than election (2) Where a provision is made in this Act or the Statutes for an’ appointment by rotation or according to seniority or other qualification the manner of rotation and determination of seniority and other, qualifications shall be such as may be prescribed. ’ ,- (1) Any casual vacancy among the members, other than ex—offieio'. i members/‘of any authority'or body of the University shall be filled in the same manner in which the member whose vacancy is to be filled up was_ chosen. and the person filling the vacancy shall be a member of such authority or body for the residue of the term for which the person whose place he fills would have been a member. "’- (2) A person _who is a member of an authority of the University as‘ representative of. another body whether of the University or outside‘. shall retain his on such authority for so long as he continues to both: representative of such body. 3 (1) No act or proceeding, of any authority or body or committee of the University shall be invalid merely by reason of :- (a) any vacancy or defect 1n the constitution thereof. .or (b) some person having taken pan in the proceedings who was no entitled to do so. or .(c) any defect in the election, nomination or appointment of a perso' acting as member thereof, or (d) any irregularity in the procedure not affecting the merits of the case‘ 'I he Executive Council may be a two- third majority of the members present an voting, remove any person from membership of any authority or other body of. (the University upon the ground that such person has been convicted of an offence which in the opinion of the Executive Council is an offence invol moral turpitude or upon the- ground that he has been guilty of scandalous conduct or had behaved 1n a manner unbecoming of a member of the Univcn l' and may upon the same grounds withdraw from any person any degree '0r certificate conferred or granted by the University . . If any question arises whether any person has been duly elected or appointed”- is entitled to be. member of any authority or other body of the UniversilYfl whether any decision of any authority or the officer or the University (incllJd 5 any questions as to the validity ofa regulation) is in conformity with this AC“ Regulations made thereunder the matter shall be referred to the Cliancellor and I“ the decision of the Chancellor theron shall be final: Provided that no reference under this section shall be made :- . i

Bar of suit

Mode of proof of University records

Power to

remove difficulties

3RTMTPT vl , 28 th-7411). 2009 . 39

more than three months after the date when the question could have been raised for the first time.

by any person other than an authority or officer of the university or a person aggrieved.-

No suit or other legal proceeding shall lie against the State Government or the University or any officer, authority or body thereof in

respect of anything done or purported or intended to be done in pursuance of the Act or Statutes made thereunder.

(1)

A copy of any receipt, application, notice, order, proceedings or a resolution of any authority or committee of the University or other documents in possessions of the University or any entry in any register duly maintained by the University if certified by the Registrar shall be received as prima facie- evidence of such receipt, application, notice, order proceedings, resolution or a document or the existence of entry in the register and shall be admitted as evidence of the matters and . transactions therein recorded where the original thereof would if produced have been admissible in evidence.

(2) No officer or servant of the University shall in any proceeding to which the University is nOt a party be required to produce any document register or other record of the University the contents of which can be proved under sub-section .(1) by a certified copy, or to appear as a witness to prove the matters and transactions recorded therein unless by order of the court made for special cause.

40. (1) The State Government may for the pulpose of remoying any difficulty by notified order direct that the provision of this Act shall during such period as may be specified in the order have effect subject lo such adaptations whether by way of modification, addition or omission as it may deem to be nedessary or expedient :

Provided that no such order shall be made after two years from the commencement of this Act.

Every order' made under sub-section (I) shall be laid before both Houses of the Stale Legislature

No order under sub- section (1) shall be called in question in any court on the ground that no .difficulty as is referred to in sub-section (1) existed-or required to be removed.

I.

OBJECTS AND REASONS

Urdu language is also spoken as mother tongue by a section of the Society.in Uttar Pradesh. The Urdu language is 'required to be developed in such a Manner that any person of the Society may continue his

study to the higher stage of learning in Urdu literature including Arabi and Pharasi languages. There is no

University in the State wherein higher study in Urdu, Arabi and Pharasi languages and research cold be

facilitated to the persons who are interested pursuing higher study in Urdu, Arabi'lnd Pharasi languages. It

has, therefore, been decided to established a University at Lucknow in the State of Uttar Pradesh bY the name

-of Arabi and Pharati University'to provide advance Knowledge and wisdom' and understanding by teaching and research in Urdu, Arabi and Pharasi languages to the scholars.

The Uttar Pradesh Arabi'Pharasi University Bill, 2009 is introduced accordingly.

By order,

P.V.KUSHWAHA

Sachiv. t07310Z10410-70410 1032 ,<Rd4si(ft0)-2009—(2233)-597 Tfedilt (WI:card-2./ a /371tFik.e) I tOkre010410—V0110 187 RiTo fam-41-2009—(2234)-850 WthZfi (0m1e.,t/er/3111:5342) I

032 RPH Sa.Vidhaika_Dats I

image38.tif

wfinamwm. nth-mt, 2009 . . 39 (a) more than three months after the date when the question could have been g raised for the first time . ‘ ' | I V" (b) by any person other than'an authority or officer of the University or a person aggrieved- .- ' Bnrufsuil 38. No suit or other legal proceeding shall lie against ,the State Government or the University or any officer, authority or body thereof in ,E‘ respect of anything donelor purported or intended to be done in pursuance of the Act or Statutes made thereunder. Modwfvmofcf 39. (l) A copy of any receipt, application, notice, order, proceedings or a UniVC’S‘WwW'dS . resolution of any authority 'or committee of the University or other documents in possessions of the University or any entry in any register duly maintained by the' University if certified by the Registrar shall be received as printa faeieevidencc of such receipt, application. notice, order proceedings, resolution or a document or the existence of entry in e _: the register and shall be admitted as evidence of the matters and _ I transactions therein recorded where the original thereof would if “ produced have been admissible in evidence. (2) No officer or servant of the University shall in any proceeding to which ' the University is not a party he required to produce any document register or other record of the University the contents of which can be proved under sub-section (1) by a certified copy, or to appear as a witness to prove the matters‘and transactions recorded therein unless by ‘ order of the court made for special cause. 3. ‘ “WHO 40. (l) The State Government may for the pur'pOse of removing any difficulty " remove difficulties by notified order direct that the provision of this Act shall during such it, ' period as may be specified in the order have efl‘ect subject to such ' adaptations whether by way of modification, addition or omission as'it may deem to be nec’essary or expedient : Provided that no such order shall be made after two years from the commencement of this Act. ' (2) Every order made under sub-section (1) shall be laid before both Houses of the Stale Legislature ' (3) No order under sub- section (1) shall be called in question in any court on the ground that no.d_ifficulty- as is referred to in sub-section (1) existed or required to be removed. " . . . . ’ OBJECTS AND REASONS Urdu language isvalso spoken as mother tongue by a section of the‘ ’societyXin Uttar Pradcsh. The - Urdu language is ‘required to be developed in such a manner that any person of the Society may continue his , Study to the higher stage of learning in Urdu literature including Arabi and Pharasi languages, There is no University in the State wherein higher study in Urdu, Arabi and Pharasi languages and research could be faCilitated to the persons who are interested pursuing higher study in Urdu, Arabi‘iind Pharasi languages. ‘lt ,has. therefore, been decided to established a University at Lucknow inthe State of Uttar Pradcsh by the name t . iOf A'rabi and Pharasi ‘Unive‘rsity‘to provide advance Knowledge and wisdom and understanding by teaching and research in Urdu, Arabi and Pharasi languages to the scholars. ‘ The Uttar Pradcsh Arabi’l’harasi University Bill, 2009’is introduced accordingly. . By order, , P.V. KUSI—lWAl-IA Sac/riv. _ ; IfI‘JV’ttolzprlto—worm 1032 W(l%o)—2009—(2233)—597 new W/a/airween y‘fil’Wthotfio—eomo 187 We lam-200942230450 wfitm' (E11213? /'€t / straw—fie)! ”‘03: KPH Sa.Vidltaika_D:tttt l - . t

SECTIONS