Uttar Pradesh act 7 of 2015 : The J.S. UNIVERSITY SHIKOHABAD, FIROZABAD, UTTAR PRADESH ACT, 2015

Department
  • Department of Higher Education

M-11-74"Carr-176 . 7ritt417 .11-W1—TfIcicrffoli1ofVFo-

5ccio/790:110-91/ 2014-16

1-4*19i thZ Ylief

41utd, kirif fri47 397vkfr ic RT WQRM

?Ai tiRiiitc

qpji, tqus (w)

('3t1' ar ai-M=4-zni)

eIN-107, ik4c11,1, 24 ‘ff, 2015

auttr-q• 3, 1937 71- 5 Tlizfq

th-ctl !az!' viva itInft artTrir—i

Ti3YIT 645 / 79-M-1-15-1M13-2015 eit.gith. 24 ‘-9', 2015

3TRRFT

fdfdkr

mi #F4E1N" arl—a 200 t al@ uvqvici 761-47:1 a.0710 1qEZcicjq itARIFC, R)a1/4r0e4iq, Maqf iNtIT, 2015 ITT d5 23 7, 2015 ault Taff t Tfft Atki Ii!seff 7 2015 kFiret rff airq79T WOW itqf vricir t I

99DtaiciL1 010161641‹, 14)auliwic, ‘ic-c-P(1471. 311iff21li, 2015 (\int< Walt 3TitTh F79 2015)

ft-fir 1/41t-cpr IctT faU17 giusci 510 •

rilftff pin wrast WI oetouf 6141q, f4r0ni(ri< ft9T3-4174

, ttfrff 34frilf9. 1882 81019 4cticf "Ole tCt, o locincf waVF f -:61 1W31q1-41-q 1-314,16twic -4 srw 3it2rfq7 Wrged-C1174 7QT114U cin4 aft3 thLtor fkrriko wf4 3t1 33,10 tlkfi1/2.4c1 Zif mar mESIT 4.)4

arfrfttrff 7TR1 '71Tirgiq4 wf cf 31rn.ftaTf 49RIT vllciit.— 1—trg 31RIfkiFf *criTO fagfatudit -111016141q, fe571W4R, ‘Iccti *If Tata •979 3Tikka9, 2015 Th—gf Wthif

act) 3:1- 1t 3177:12ll 31effft 'PT 3TRAVIT /1— M jqftq j ur-o:Rf 1. xcriacircrog met %ANN<

(310 c41.4 wr wr-eTzi fayuldeirevi w-qtr 414 ait3 z4-4-qt zfr f$311 an 414 34. t;

is4S, RPH.Dme•I yie.zois

trNiid

image0.tif

smz-m‘ l-nm'udu «115 A A ‘ fé‘thézuazm Mmmwwmmgnmmwmumm) fgttawmaauemawgwam'mmwg) M - wwwfilahwmmwflmm—z Immlwslozmgm mm lag]: alga 21:11am Emma-W 0mm mm mm —1%WWEEWW§MM$W¢ML _ W '- Msammemgemwsfimmwmwfiwmww mwwwwmxgmmgmflwmg mwawmm'gaéfiguma,megmgezw'WML. nwgmm'wg'mmmmlmw Um§2gmm222nhmngmgunaamgfl '- (smzmtmmgwnga) . ‘ SLOZ'WMM'EM'MWMMOMQQ ‘ Iglmmuzsg WMWfiMgmgmgsmzflzmawmgfim _g21@§hmgb£keghsmzfia azmmstoz‘mg m_m‘21mmwfimg§ug hmmgmomeggngnamumm$oozzgaikegzumggmmzmnt m SLOZ'Eh vz‘m . stoz-9L($)L-9L—L-gl—sz/9v9 imp. L—lzlhffle gang; um: mgr: my; lamb: 9m: test '2 m 9103 'h‘h :73 3.123% mum; (W man ma) (:2) m 'L—ldh. WM" a 2mm 2Q app ‘2 $3.511»; 9L—vLoz/ Ls—oumom/OEE V wm/omomOM—Lm: Mr A @ gzL—m—m

-

2 ( warsr 3rTrrs1rTur , 24 , 2015

(Tr) cfAcli , Vit—cgc,11 , VatIlt" 3N. "ITI--cpflift mrr .droTzf fara-erra-zr Z ca9zr crprDurf? , uRr—crpiR1416 , Tatrff- 3th ..srra—ctrprf t;

(Er) -Fir' ml iiwzI fzci14are-yr t t; P44)/umr4 t trier , sath

trzruff zrr 3t1ErRtrit 4 *Nli tikr .m-R1 cr*)' crinwr trg ff4g-ou &Ayr t;

() "ffi4trirs' ml 11Wd 3114719 fbTrir t 3th fas9-4 arszitm 31-57#-IN t;

(u) cp.itriqt rur-o-rzt fdcavarcyrer iiThEr4vr fiW#arfti t aft fiiw f4c1vieiti 3rEirmzr- -Err co4tria Wf *arr r Ic* flThTf1cT t;

(W) ct,i4qRc i ur-o-4-4 ftraftr-dzr rzf trft,r4 g; (sr) 14Nrirr Trtatireit ml dwit TrtlfW1(10 ITT 1+21-1 t

zzimirftrT Pam 74-r9 cNcir UtIT friflk fclfaucriq ed749- TIRT tic11-11 d241 &Tad- IRTT113. t;

111N1ffaxuRvietzr* tict)14 t;

(3-) Ist,1141€ Th-T . Uffcrzi RYcl1411(14 t71)1741/101,11 to1,1141t1 t t;

(3) "RtalT/ 1-161 Vida ml 1TT4 f1cPii4 IIc iftra zrr Trarr t *tf 3AffiEr4 ath liftzrrri 3pDrh

fcrPviclir gkr WIT143 ZIT 3T-Tau TIT 3WFk ti6Thl T1 ZIT 394,1- tIt4 ch er;

().. flra" urdirri Mitrff t: (U) " 31-ftat 3t1 V Cr r r91mr urNzf cr wcriu 34iff'd

t;

(7) twit) fltkl ml 3WI4 TTRI—trig tiR Th\--417-1 TRchk. TT 1 7-24-flu -S Thm-R4 t, zrErr M-Vqftti 311-a9- arizbr ath 9,kic 31-pfic arrF WP37:1T Thlf4Ta. 175TR. ja149-Wa UjCJ9., Tv mitta arrcit I frbthl

1 CIEck4r9 Oft-a. s4tc4 eftr aircF -PsErr,Pvi ift-fri mlfThra,

41%'-ctio tilfti aiiq,tigErr, ksITS Oft-F tr.17vir );--S :c1.!

cf). 1ftei LbN 1Uzj.cAttft-19, EFF411 k eitic9,311.14i '11)3Eri IT1 g; ,

(e1-) "T-IRP14-111- 3th -3-TalrOtmi 311-tf 3N-Przi str la-strfaErr6t trr t-rrzr icrinz-r4 ath 3ts2irer 1t;

(0!

(Er) 13-r w-ecrif ffircrear-trifFzi ftrrec tC-il ThT# 13T (") -ibefric-14 31azITEW" ml 37:rd 3T1'EIR1, ‘341iTRI,

tt.R745 arrirrzi, slisEmro, 3th t R,Fg f%rricritr ftlalT/1791-Fur MCf-fTh7-4 TIT 71-1W 39.--TitrITI c ft9T, f1R-1-43 fOTT 342IthlY T1 arsirri *14 4 ,T4-rf9;to- frErr

(sr)m--1brrEtrai qc.1dficr" rq .cric.ftrThrr. • ME-ic frftl.,FcF Trffwitris4tr crAcitYik-N, Zbl arTril &maim, cr3eitrior, ‘31:1 ,143,71,HRIcf. thfff 3arTh-r, EiT fitzFich,

T:r9ThlairlaIET TIT c;jc•Ifral-TT t;

CI i; 4 KI?IID lIt IV I d I •

image1.tif

2 wfimwwwm14wlo1s (:1) 3311131113 "um—W13", 33—11113" 31: 1113141331131" 311 '1'” 1113121 13331113113111 21% 351121: “W113, 'm—W "213711113“ 3111 l ”913433711113”? 3; 1' (H)‘W'zfi13fiufifi$afimafiw113; (§)NW/WWWWWW,WWW 3mmmmfifiwwfimm$w3§figfi~ 31131-11132 (31)"W’H11Wfia1mfifiw1133fi1mmmefi3 WWWWE‘; (11) “W"Wamfisafimmmfigfimwfiafiéam Wfiwfiwaanmeafizfiaww 111141111313; (U1) "21112111fiu3"a11311t121fi1$31fiamzfi131121 W‘fié; (31) ”Wfirfirénau' mafifinmmmfim1fi3vfi ammfiai WW 217—1111 3 am WW 7113312171 36111 6111‘: mamamafimmmfia‘s‘; (31')W"‘cfi131q11fi¥afi3113121$1131111113; (3) “11513113111 w'mmfifisafimmifivhwfi/m131mm 11%; (3)'W/2131fi3113111“2171 11111111 133111111 1131133113111 11133 Q11 mammwfiévfiwaféfimmqfifimfifimw mefifimwmammmfimmr 11m 31; (31 13133” 1111 313111 ufiffimfi 3111 131311 11 3: (3) 'WWW" WWWZBMWW 11111121111 11 fi; - (U1) ”Wm—=11 111211121” 2111 313121 31121—111121 111 21135111 11111111 3111 3.111% 3113133 W 11 3, H211 WWH 3133111 31121111 3111 1311111 31111111 3113 31113111 251%?1 rm m1? W111, €111 31111111 311111 31315311, @1211 31:11:13 $111131 3331 «1111131 311111 3133211, 3 31632111 111111 3711113 1, 111M161 611111111 31111 3193211 #31131 117111111 11711? #1311 QTJEESFL 11:31 (111611161 1511 91113211 21131113 111111111 6111121 311115 3193211 2112 (11) ‘ufiflwfi 3111 “3112113111" 2131 1113111 1111121 L133 Iawfawm t5? £51121: WW1 3113 awfiwfi 11 3}; (£1) "11131“ :51 1113121 13311133113111 21% Yfififx’ 11' 3‘1 W11 8'51 11 3; '1‘ (3) “13311135113121 21‘: 3122111131” an 11111111 31171121, (111111121 111' 3113111 11312135 31131121 1112211113: 3111 $11 3131 62112111111 11 3" R173 13331312113111 111;; 131811/ufé1a1v1 $1313 373% 111 31121 11311313 211—13 :5 m 1113133 @1211 mm 3.111 awfifimmaéwfifimfifimm; (u) "manna", "=ch"1!‘1114£|", “1111 1151111qu ”13m 31111112111", "1151811 9121:5111", Emma :11 'Ww‘ 211 6113121 13331131111321 25 3131121: 3": 3111111211311 2137131133 $1 33111133 1331 31121112111, WET 171131211 1f 31113131319151 :11 13311311111175 11 3‘: 3 “ . ' 1g} :41 KPH 11-11;. 1 mu Z111: » 1g

ZIR(Ft'YT SITTITIT c, 24 ‘11,1, 2015

dMill 31iffIT,T11, 1882 3149 fiqci 611 UTff tc1P3T ffcb'h5i4i< Rrih,iiciiq, 'aT1171te" OLe t;

(14) -Th-seraTT- Th-T ST '3 31}119 TaTTfte tOkRiO jcI[ EJIclT ftrt-itT4R, kicci•Z IfTbr t I

3—(1) 1rtii feff qrtMINTq Nick-1,4 Iftte A nhazr IT 3Tgl • LK 1882 fthar4vraz 349 ti—a7 4t 71-11vi WargiR, Thnl Te111171F

td gre rit0KT-e0 I cIfc1lc14 Pit)5NIC, \35kttyraTa 979 3-1 Krw faxcriaview met TerizrAT Tz)-Tft

(2) faxcdacrierzr \r- .1-4.11Acr Thm-rzr Pii

4—td. 13ft Altilutch f24M-RI t, re 3TMMTI 3Ts1119 Yci Ttiffle iazi 4)74 AZt791 A Th...ifgtqcr Thati -ip.mrqr

1:Erg vid (W) "in.44 io.00 mt-q mat wiz?' Id.-zotr fARr mat wrzrAr met wilt;

(R3r) fasaikrrair ftita. Ro-dri 40 kt4 14 •<.44-k .14 grnd 15I IRci i<firacci e,

.(Tr) 331-Er& (u) M flftrz ci wq A WTI 24000 Whii-23, cbi•Zt)? IZRLIT if 11-C-9 MR mtri ftrz,r4 A Roar( 50 AMWffin 31:1thiT ttfuri4 3ftz crsiffrekm sralcnl: A Rip) fm-zo qrriAr;

• (Er) wirt- NO A fAltz 1T-4* tujkiz STRNT4T1R134 q iii 444 *1144 •c•41 ‘34 to( 311ftelli IT49 jaraiturnr .zpzir4 aerr 3rRT.uzr41-ar ath 1h wzrthrizr i1r91)41m-zr met ri.17f1 MIT 3ITTITT11 at 4 WE •TR' ctra4 \'9,4 4) Ikcett tr41q7 arrferat mzr aza-farcrAr 3j120.Trzi RA-4-or (u) 4 ‘31Z.v1limcr 1Taff t 131Wi] MIT SI 31701/4re4 317 th" 311311vt4 ei•aqi .4,.<4 Th.c cycm€14 vlzrr;

(u) sraTm.fAATA zrr WRI1T MTI KIT 3T1WRI, Tr&arrq-rzt mir

allwrzi 4) WI fttiWi COM;

(ET) IF?! q, el LI wr 4-e eilu ti4A1lTr-M 4rNm-14 in mzr fm-zrr oru)Ar iitu Wan dn ci41 AzafM'A

T?.1T 311. 1tftl 43PIT1311 tn7ffil irkT 71T-4 '<nqa Thnta ct"') Thn.t Mci•ig4c11

(U') ta-r- zrra,zr waf z.4 zraT Ard1Wrat. Ar4zr waf m79

.; .ri fatTi, ara-faar ;r•Acyrqr4r aer-v, Azfrzr tar N9-gzr\-70 azu 71rcc1il cAad (b), (VTAitt) Thcl WtarriA Tha5r0

AirrmI orlzow ZAZIWT ct).) Met crel-1614(1T -011;

faTathuTeizr arian 31RTYTI (101.A1.). o4tg-6 Arreta viRw %err '•ARtrz: aih Ara

in ti r lfZ1T1 .31,

11 R4E4IUNT

rtztorrzil gTRI- PIORa T119iM RI11l 911 .Thel vat;

(T) fittingti M wrivftift fq AfAza.M14 met ztitzru uzar 31.1 ThaniTimit thrIT3ii ThA 3:ted-d• cm4 in twrd TIRT4T; •

t• TreaUTM.1 crurzTA oth ti-cocirr f&A zrRftrarr 417 34zz4rezr

-T1171:

.(t) fatrafficrierg gr.6 4r T:r4 cr, 4 t 0 view arpm airthrr 7 1:4:1 fAnarr- rcurpti arf0tru;r %karrra-a1 zrAmAl f4-;A Aft

image2.tif

Hm m swarm TIE—C, 24 5m, 2015 4! (H) we Fm HIHni NRHTu HIIH am 1882 H 3121171 Vfileg—d fiWmmmWw,Pmmmmm 'Wfifi” Wb; - (w) "fiafimau" a?! Hm aim '3 $ 312117! wfihH frown WPWRMWWWWIHE‘I 3— (1) )firifi’rsmz WWMWWWH°WW3®W 1332 Hmmmmammmw W,m‘rnafi HWPH” mmfiowofiwfiammmmmm szr‘z-Hmfi wfiwfiafiuafimwfimfil (2)13WWW1WWWJ 4—m,vfimmfiafiu%,wmfiw$mfimfimmm HfifimfiHWfigfimmmz— (as) scram‘oomaammmmmafimm; . (meSHfimHIHQWHLHHHwWWLfiHjfigé-mm mwfimmfiafi; 1 (70m(wfifif‘a‘lzogfiwmfimmooafifiiamdzvfim vafinimafimffimfifiwsoufismmmfimfiafi? usuHPfifi uzfiwfia‘: m 137m Hrz’nn; ~01) avswflfifi‘tzmfimmmnamfifinfifihw WWQEHW,W,W,mmafimm, 'mmrgfiaflmm-Wsflvfivmmwafififlfl mmmw¥fiwmmmma§wwmwfim WmmwgmmmyfimtfiHWHfimm wmwfiwsfiimwfiwmmm$mmfim (wmfinmmwfimfimwmjfiwmw unifiHmfimmwfifinmm‘rfigmm; (mafimfigwmmmafigwa‘éamsfimm 1 »Wmmwrmmafifigfifiwfimfi,mam,fiaafih ww.mgfimfiéflwmmmwfifiumm vafiamifi‘fi; '(fi)m$,ffiqmw$mnfifim.mmififlfi . JIfoHf‘am’, arc-flare WW W11 2mm, may} mafia Hm . » 15":lflmql (WWW) Hal W21 $33 2m (@1111?!) a fiPmmm Pamfi a: ': ‘IIIHHfi iii sigm‘ tame“ HRH Eh"! WI E‘Ffi; (50193313616111 3am 3mm (qvfifl’fl), m man wfim firm -"-1_iR!u'd (\ 3mg mag) efiq Ef‘w-“a 2n WW MW Em mm an: Hamm; ' :‘fl‘emzfi gm {Huffia WHEY vista? 21% 11% 3‘?! WM}; ’ (31) fisfifiiflm a? 251mm :29 m Whfi ea mm Han 3W Wm 13mm 2m mm W "or?! am! afar; - (3t) mm 23 WNW em Ham 2% m wfian 3m mane?! ,‘ '.'v: "(flfiyafimmafins‘mmmfiwfimmmmamw aamfafimws—mmmfiwwfimfimmmfiffifififi Him _ Qumran 5‘?! mm?" mammal: m mm a‘: m slfi

fasarazaz iii 311'el

f-43albaa1 W ‘itt4744

Pt4T 317IRTTPT%MIR, 24 ‘7, 2015

zci 1:117-4aVff1iuf TI-4TF-4 tg Thf471I94) (bit 1;131 mita

znite-mill -tre--mw %main;

(01.444 *New4,--rm- 191t4ffil 34.-d7Ta tR 3t-01ra <MI TI71 TIEM 117

3r41 ZtiffetT wra411 atat;

4A1 3474 stJ fa-94 faxafauraw 4 wra-ar W tka ftt

Thc1 31.41T touir *Nchr( KTT Thet viI41 I

5-0) •tiutf •1-NOK URI fa7cIr41Ic1LI ffig

ATRWR tr5 aft f44q .11,1W aro-ra faxofatocro cra1a7 3117121 cr)Ilf I

(2) •I•Ttl ti•tc:oiC ct.d 3TRR1 T1 31fira4 iittU 3RihtEr VIT41-11 PRE

traRi URI 4 -Fe& arg w3 al 7-4 t 1TIRIVIR riTit M-7411

6-fa-rem-Ka i517--q-aaa faso 4 WI armait -41 1-1t41 1'4 -ra:cur-az/ ar

31Ta71, tT 3il3 fawn -33K711 lottraa araiur or<o1, WT [td Wlvra ii

31Thgt etr<-11 514If 3117 faxofacimo 134-47I att3 ararra4 f*-1-Poitia

crt-4'a faq atragrw ThcIiOT a13 ara TR@ 44.44 wr ;Rut a-414o:-

(w) firer! 31 Sr ormr 1=3331 tuckoo,91 tTrtko-rt, 319.11'R

110TERT 3117 sliffiuk, ffi rRare Th- Rit sivuuk fkw 9I411

31R tO 3T-41 t -141-1 Wet 3t7 caud 3117 7E177-/

14ifffm :n-4143mi tIct;

(Tio falt VITUS NUR@ Thtt al-Gr

(TT) 31. 7118171 31a1/49 S1 at crwii,

(17) .4141 k;,61,:twii, grim-goer-di. twii tv-Ntior S 317ifilleRI

\T Aftwar 4 am: FS-MI

Mse4t4c14 4 7—Rxcipacitiim 1:4271Ntgct tif Mi. 1'31 *icor ft14W91010t)

3fN

.<1 'LOP( gRT tau Rxo---17-ba 341-3 4-osichl W 319-117:-

M idea 4 tit antral k frg- taxofatoclo *No -ono 73 arwaRa-

wk, f3m7 WI azwair aror afi-3 7fltr W MT ui 317 Sr@ Mr)" 31.51cft

5 U'aT zti fAtitm u1-07211 cM-11,

(7K) ftM, 3TRITIffW (td ThIWIThrt , ta4Z/ctif R iit

3111,4-017, t -11.44c-or fo-ar7, 31R1 lliT 1t0T9 too,o ,p4r faDitecr:

\ifZmfbct 7t1 t. ga-att, au-sta, -41w41, -034#13411, ta-3143.11, Ricg. asj

fewair ?am, writ, writ, ant, 61cer srd ant= v47r, &

cic1

al

701:M 171-44-V1 wi, tii<tzkf, otPivo, 312.1111Te31, 111T

71-17, feat 14,mino1, fewi, *It, war, 1rtf13 ftrat ailft

W14-dfl tR fatiraPos URT tivr fa113ocr 7-‘14 ,44+4. 31-11F-ta171.

Yr:54117 W17-7 a t39 W rata7 t 3174 faqo iff <;.-C titii et

31P-1-41 T7Q.T flrea (4,144041- auk \Ito thIbnwi 14.4tortaa

tou-trro tr3 fe4a-aa favAT TI1tZ111 91ifff tRR cM•11 3117 39-4

311;11tril M-791;

(7) ftarfaal ta3a4-ra 34124474 4 calt-fa \'ffiftawi ar -w-Tio

tiaina w37t;

(tr) W 34117 3-6t Thaafauraa ataarRa w1, wfbtal

4 titan, irt4iorr ar alien 4 fw3t 34- 74 qi1i W anan t17 1. 1-cti1+11

TRiful-t1-5 Stall 7-a1-R4 at- r tTfiTh factrza4 cr-4-r9 4*-li 3117

ct>10ft 4i4 ArcruTC1, 3CREtrZil teiRr43 Wardi3t

MEM *ffi;

240 KPH Data I Vid-2015 ).

image3.tif

m warm 71312.24 5132016 4__________31____,__’_—'—————— A, (afiyafimmu 2% WW? Wmfififiumfi fiamfi am am My mmfim‘iafi "WW W'Wmvmim; _ (ammmfiwffiamf—IWWWWHQMW mummafiwfififimmfifiwfiffi; (QWWYIfiWWWEQWZEEdIfifiTfiEfi 2m mmmvwamafiml WWW sum (amalmawfisvmmafiraufimasréfimwmm' W$W%m4fififiewnfifimfinéfi,mmfimm| m'mmmmmmammmmmmmmw Wfimmawmgfimfimmfimmmz— ‘ (afimfimwmmfimfiafimmm, g i 3 i 3 § 3 i E7 filmfiamuafi 7— am -wmmfifififim—fié¥fimmfiwmlmme :3: 9» 3;; é a 3 :1 37 31151qu awn; 4 V (Infirmafiqfiqmmmfiafimmifimmfi 12 WIND?! 25w;

‘3-0,1 31-€1STRT quid, 24 ‘7, 2015.

(z) fd120 R) 411‹ wqrf0-4 zri 3T-1CON 14<i-f (zi) 04 ant-let m*. faxafklIcitl ,(14•W t; ft:rut mu

crfteivi A-417 cb*if 374/Ta• 1:15MR 30 04 304 tliqqa*I 411

(0) Mr410.11-az1 gkr ar4fw Thcicb Trd, ;SA c , 34--4r4 trd, 31U311t4141 IR/ \iwitil4 74. ti6i4ct) 31r4r4 tR, muuqzi WC 30 301 31tiricrff

&PRi Ig1,49 ,<1\41.4 *Ncol.i ThAwricrItil ar-1-3th

Tifkro cmdr 3th 31-c cm-1r,

wzthrtetzr, W4woffizr 3th ar-r Tra •41 ctreg mrr tr7

Thflkiqi cfrmr;

it-41 ar4r zci view irr ii410-1 wth-d tñ uncle& 1r=i fdftre -o-r9 7P-4-211 wcr zrr ff+-41 falWtd ara feq 0.0-1

Z11 0113q eiqfrif;

"thr ath Rthr Sft-A am:r xci ciievr zrr wffizrr Ti-orr tin tIft 34'17 cP4-wT u),Hr qz(11441c14 31AsTrita wt,

3T-0-14 qflur ZIT ‘i•icbl \I16TM ctrMi;

(Z) Yaw atti. ftar S ftq 1jj3,ci,j fljtq,çç 4irrierr34 wt-rsti. ieTTA9Taftn arliaTuf cmlf tiftRxcif4c4iqw,4,wzr 4 -u-fr*

wa-tar 4-344-frz cm.?5 1Ik arrthw (u) 3ittifirffei, aiicjRidI, efica cr141. 14<ch 30 turftdfifW

Tiftem EM•11 311i ;(4-r9 ctrHT;

(z) fthermll S344M &wit,1Ilc4Itif ii -Rw49-r 31-53eTui ‘3101 vITT WF5iYkr4 St= "q iiffireif 30 till-H-4

chetiful Q,jujØpjlinT1M-FTM TernifiW ctr<41;

vntr afr itirT411 tmf3II S u4tha r 3ft7 ‘ictri 3VZTwiwratf T tifl Svatr arwerr 4 tift-&cr zfidr

zc,•a i 31Iq4cl, ii4151;

(13T) 1-1Rflti44 3170 thrr -Nit <bet Tiwr, f4-144 zrr raw u

-Enthll co d;

(u) fxe4 wog 4 14 gf S T4q z -sr tt TIPTORIvg S TIFTThi ar-gth fkrfftd

4-11 fZiutar4Tru trfterr re4144-r trr -4-41eror itt cr,) tr7‘f

wwidt *;

(21-) -4-fr zth 3141 u4rt 4 TOT 0,411 30 \I-Dbf 1jTaT9 AI ;

M lift-draft 74. 3021 ci iTRI--#T 4 Pi q W0P-TT cMrlf trr zci woo alto tigiSI;

(S.T) ft/catnelef S 44=400 AR vi - it 4 3r-grri:m faRtirkr ‘iiichf AT-69 cr,ddr 347 nr -ffir-4.r 4 th4 3740Tf. 41 c.N ITT fth-dfd-cff-6-4Il 31icp t19Sl1 WiT ,

(9) 1thditvr--611 S o4tiiPdf*or 021 ath 11'44 chetil 1* iir-447 #, tem u.141P-11 ctrt•iT;

10-0ftureizaS Thc-Uii S friq --rd AN Th-if tr$-in

ni wffii irn 3bth ww. crwr ath f4R -R-Err tM ft; .

image4.tif

fume 10»ng age mm mm 14219 L02. gpmi m maegugauemuegunmmgjglmmgnmmgaegw,f timmmwg wgmmwmmgwgmm (L) .m1mmmm2nmngmg Mmmwmflegggmfltzswmmmg wmwmymwwaewmn) WWW ‘mtsmmmwyrmaaewmmmwm immwfimwmwwwmwww away waggmmanmuemlmghwmmwm '@M$M/M@L¢EM$M§WM® .muzaunm‘n= @Mmmgma‘aewmuflw$ww(m) fmmfiue magma“ : wwW§WMM$mmmmmm gwmeamuelwamwmmwwwwca) 519.12 lebrggngzgmng WMIM MWMMQQmmgmmmémmmm mfiwwmwwmmwmmwwwwmm . nagmgngL-awemmga & W w‘m 'Awhna; 'mfzm 'W (2) ’ famm$mmwm mgmffi'mfigmflmfimwm ge‘gLSJg-g me: MWWW'M'WwéfiWQWWQ) fmuaMmmmnm‘ 'M'&WWWM$WMMREWM ammmmmmmmmwgmwmam) A fmuuazhmm mmwgwwwmammgemhtfiam w'mmmmymmmwwmw (15) mmg whammmwgnmmnmmmmm fmmaqfigwgflwwwa mgwggwmwwwmhuwgm mmmwhueughmm'uwma'ahmm/Ahmmma 'ahmm'ahwm'ahmwwmmwwmgm) 3w mumbmwwumwmmmm 1122me agihmgmagmguauemmga ) immmmmwmm-amaama) am He vz 2&1me .

6 3VR TitZT 3T-fritiRuf -1E-A-

Z, 24 ‘9, 2015

(L5) fa-SIMI * II-0791 feg "Oz * 39-4-47 "awl $1

via -St vrallit tw trwet zqw AAT AT wfl atm Tam;

(a) TtiAt m SI fat 37..TR 1zR $ zrzirtru 31T -44, gedfg5a &Rid

Sgiflittli, Nd(U1311, fdg-1-4, Th--aTWRI, 1:11-4zIWR

kEr4 aiR 01 31R1 vATR11

-$1 ?Art MR9-1 fel-Sall 34-kgr1 Th-\ &SR MRA

-1) liI1lIV7 IRI9

ThR Tr-- ;

(A) ant-041-91l VI 3TEll-lTh 31R SR Ikal -V 3TillW ThR711 ail itiAT

kii; aftR .

(TO tA ar71 ITITI Th-cd 3IR Th:g1 WT-41

%--t z-Oval tt ;AI fo-7 aawc4/P. 3Tr

-gem ziT Calln‘r 1

seavi ati 13-0) Ib19 tfa m-

rztwqi A crAv wmAt vim fat sil -q fasS-dt

terf!M ;WM 3iT417 31TZ1)11 01,11 Al ArAe) t argrR itt wr?:EA 1

-

itraitzliati at Tau m-kAT it fatal

gm fs4t Ti? tira:ZWril *

tift ATA-- fa/arra -a Nym 3trztiT mu

3T- 1 S f4wrzi WMII:4

ftva-fx-bA &Tin t 1

3itat51- 39-clla ltreall-OTI 3T -i-41-4 Vern iff

Mitt tritiq 1,

earr-Mvii t air a 1 ,

T-cgAgra rfit Tit Ri l ttift1T- fola0 Sr trlAit

vrA/Tw .

WW/ 3TRI f4arg- ffi-s- rt gm fAlltitd ATASi TR ibaltarazi teifilr m

-rzil Si

trffa-trTra tri Triterr m-seil f2- Wi 7- Natal' \rd aw 31

--- 1 CC-iLl BIll WfrA t t '

CClfzi 71- 1 11-T-t--R grz -Am fAr41z ftA 7rtit 1

,,,

31=5 Rr 31-4/ t fdtem iTatzt tem em

ti tft 3IR 3TRRI *1 lift

-A Ar t At tA atti ?mit -wall gm amz) zi 3t kr

- ittaavaTaA “ tit tiro

,

-AfAft NA-141 t3A1- 8 %--griZrcrea srfgu m

-tTA 3113 wkr0 farecarFa 4 . 1A-1 A . '

striR yracizm miztarl tg .S fat wird ft-

al wircti tili0 A fttir8 t-r- • .

crft (ASTRA gril - A 11 ThlItagl aR.T Tatt

/W-aT IRWR *A 7RITCI 1 i .,

ftped-awl 9--TdItEret1 SIS frf, As], Tra, wit za a

-rt -“tert t Fe'tq t -rri si17

• , ,

.ipt wo13tri Thearga fe zrg !Sam

At tra it at it-RA -afro * ffie it(11 arRrm-M,

Tr-draaftErtil t 31141t1, Wl1 /2-ffiti Ill UP t --

ct A zwl iatzt WI atA t M .q zri wgzli Sr4 Era ,

I'M btu q-Rut . ThRA * faq TR at t iFrd- m--T

I'M Wcri TTA -$ B-c- ava t tirfit

. , -' .1

?OW-Er AT WWCTEI . 1Th-t OM It tr, A

-CR BWI tR 3-aera tt

tri- trg it 31"- Tilltd 71n711/317gt-U a-alrallV171.ftei

* 31.1 fitO

WII 4) al-WO fm fAvaltcriali A at m.il m

-AaTftal a Adi 1cTR .a.2.il Wt. ''

Kir A ies-r51 ird- V1 IR 3Ther lifflSTR( IR -Cal TRTh

lR *. 31T-a-V11 TR-1

fe4afAv itat qltlIn 1

Marra-Li t io-fdreaTIWI '$

f'a 3E41 3Titlt.t41 tl)':-

St (.) T2aarcrea;

. (730 sit T.,-FiRgra;

1 i

(Il) T,FITik

, )

(tr) Cift ITh7gcrfk

(t) 1=4-a-zrraltrzl,

i.

() T,F a; .. ,

. ,

(0) #m-ra) ilaitztai; j

,

3btt1110mn I Vel-:(.15

image5.tif

:40 KPH ”am ! \M—zI-H

ati 5rkvir%r+ITEIRT 24 39, 2015 7

(*) zsm cpetiruT t-r titiznara,

(T) zten- Atm*,

Ta-r-gpat, t.

a (e) OTTRZfei;

(3) 1. crf 311t-71t; 3iR

(3) 3T-1 af071€1 gl7 Ycl T 3a1TR) ring

11-0)* ;mu *At gni t9- atf 3r-a-fM7cjIqf fA.gfft* urr4711

. (2) p,eina arcr4 ERT, tItzrd 31/2 zu weft! zrErr9 6 id- ath at-er 01 q qg 51 ,Ici-r ct) ,111

(3) . •Th:d1MtlttcTh"1 \Lk 1c1 Wren af..4 giil 7.07 TR 019 7ircirt

12-(1) crA cr3era-Gr *1 Aro* 5ie ;177-47 *M1 zr3f 31/2 srft *,erDrift gia zr4 * \I *rtrift 4.Tarra

(2) ;it tetiWt tfirrfOzred t-1 ‘314)cZçcji T 14ei 11/2 gor cr,,tr 391:ftft temr 3:1717 TT iiITTIFfaR ct)01.

(3) VM Cr;e4 rts-f Ctri a 14 ra M wi'IRIcitiiiiRd & 9réi747 IR RIPT iichcll

13-0) ctri4e6.0431 IWZPVE 1-1 NF th9 4 T "17 tit tea 34 If cg 7r4711 fdtd Th`t u177 I

clogrei lYci tAci<1 TT Tilpf cl,idtietcl 311-3 terfrit 7.fITT41 6 Air 3th xa sumo* 1.441. tfikEigTM 0)77TT 013 TT 77faT 6)4 0 ath fazafacucia *m-1-4

*-d-r* tz3 tipiitzt zrzi-aarur 303 fAzMur ,4Sirr 717 faTafac11c14 ‘9111-cf 1014thiPen. T ftAswa crIzrai cA•ii

441.a With. T1 71.4 g'-ci TR-at cN-IT 311-477IT g) UI 7R1fr3 k1 Zn 314R fazafatuder * f matpa. t.sr wgft311

yfer -*T crair *3. \mom t att3 gile1/2 T1 mu wrzfart 31/2 vif0*-rt

3T-a-rm t-gram:

cr3-rg zr6 14--aft..ficia tet wrzt3. ft-31) crart-rt aar 4Ri 3tIZTRT 3111.9 clAcicia gRT 11)) TR.51.6) afftg. g), 113 3TRITR 001 r$

Ara* * 3t3pa 14,a alp1/2 * kr* Tut * ctriatiRr *-1 p1/2 *R1-aTtr *

wa-cirftrzfa tejyki gNr tza ol4q161 *1 aft m-3 tor t vikffn*-3 \moor t aa acid atm t

ctrita STR zir4044) 15I ITT1T $17 311 T.T *RN I thll Rftd ca”.0. 7R1 I

14-(i) git cgc,041Rr 7Sr ftZPVI cgc-I4 crnd zrPr44- arT31-<7 31/2 *I wit T.,--d-trfa 711117)111 afrg3 tit 4I1404-1)jrcRI)11 <001. aM T-4-d11 TT titHq-f c001 uhif falII itzrr 7114

(2) 310WRE T 3141)9. mr4i1 crt qpqR 37-4R1 * alzr4 *-4-4 * A-4-0 -**RI ariz *kat wr 1=44-ri

. (3) crth cipqra, ala 30 74 cl2c14 ci gRT 70L'11 WM, it7 T WO-011 T 1:144707 11/2 ,t3eitar mat a6No1 cr, qf

image6.tif

Ema EwkEEmWamermwawg. mgraamfigfifiggwfiggfia, .Efiafifififisgwfia wfimgafifiggfifigwfizw VEANV :mfigmflfl EEEEEfié Ehfigfifiwgfi‘éefls fi¢E§w§EEE§%E§3é _Es&£a§ EEEEEwfifiEEEEEE: figmwwfimfimgmnpmmau fismggemfifisEEEEEkfimfig wfifiwfifigfigwgéwgfiagwgg Méggfifiawgfififififirfinwgfi Eggs EE.E¢E%EE&§E“: ”EEmE figggfisfiwfifiwgfifimggfiafifiw EEEEEwEfiEéESEEEwfi fimggfifisgrggréfigaie . , Efigfigae wEEwEEVfiEEWfiEfiEEEE Ewggéémgfiggggfiawg £0 Egéagmgwmufifigggs Erfifiafiwefi fiwgfifiwfirfifigfiwfigfiépfimefi .mEVfiEE, EEEEEEEEEE: _Emfigfifimfigfimfi¢£§fibfimgfl Eggrmwawfiewgfigflfiaggs éfisfiéfigwfiwfiaémw wEwEEfififigfifiéflsgsé .mélfiw ‘ EEEEEEEfiwfiEEEC _EEEN§E Egyfisfimgfigawfififibgggc . a _E%EE figfifigfifigfiggwfinvu: :EE ngEEEEEEEg “58E Eu. EE m5 AM 28 Eu VN ME. EVE E9 (if; (c; ‘m"?

39 3tht 31311RTIT TIT0W- 24 vIzt 2015

(4) wvf 3-0-4t 9-97Tti1 MT HI-Jail 110-d W@TT frd-,11 alAsuftn

T3TRI I

15-- icr)/tri--rz•I MpTr 441 t-10 t MIT tkiT

ver/T 31TR qez11 i t4t4I4-1 ct>01. 14 %%i tsi uflo

16-0) 42,c4-St fkgrer trf t -itr11171i c.61 wzr

crIca tthA wroi A-41 fff 1- zc1vici4 3t7 arq-A-4-1 cr),

6torai7 mi aifr-A7t 3aPCITITPTa co4 317z[ 7111-1

4 ;rem ct,nI attR t(-) 3TRTSTRA 5T 1L(14-r ct)4i1 lur iti%i 'tau

rgcsi afRT OI44Rt14 a1 fatityRtic MT IzIt9. 117 ,(-15ta t-MA 04111

17-Wa twraTuRi 4 fer41 ftt 4 ApirA aft/ A-6 vifiAAA't

Witri cbIf 31)-1 McTrzht tiLlICs-1 ct) 111 at-I1 faftn- f'srr writ

ssiam 18-4-Errarai Th-z-sf* -(T41 11*0- t w-4711 3t17

co 1 3.TtR t{) STJ-ZIT 15T tik4i•- 1 cb1U1WIT faita 1:27-11 \Jilt( I

ad-Mmt 1G-- (1) Rcd 34RITMI Mct Nffo t wkiii 3117 -tr

vifT0

ml Iraq 45 111 3frg ti4 M71) M1 tiLlIcyr c4) .4 0. 61\ti1 'NmP- ffiTIT ‘3114

(2) itt?f3Tf0-4,-rt f4-ffi blirr

3174.1 3T(01"41 20--T5N MF41171 tItaiT Pe3t17 Nal TM-TIMM 7-frP

RS( 3Tt Sr1-34 fkzPit1I ift W4: 127-1 tR 1TA fat-d

f -trr

foaftnd 21—firaar611 P4-11k2w viRwitr *-

gr-FE) amtr () iNt;

(R3) cr) I 4 4;

(Tr) fam ANA;

(Er) 1'4 Trfilit;

ftiluirr A-1-4

(A Tt4A A -g;

(E5)

trtmir ti

3TR:I m-rtimr-tt trff4Thzp-il glI aft-ad P0-411.

Rro War •Wit

22-(1) P1T flT43-9 3fr AT4t fdtit-t-t •

7rai

(2) a311414Ars wq-A-411$ 314-9 •< 3911T 1-M-1 d - Tr4cTRII aft

t4, 3124h,

(M) f4S S) <4040 Aftirn 3417 440 --Tr TilTz1-\4 4171 1 :R 1941em

m-R91 3417 ffiI t 4)14quile?f, ‘3 -̂1 41'f 3N fare S ffç 3TT-2FRIT

MT VITcl- a•-0;

(-a) ffi-,S a ittr8 3 a A - 11: 3117 zi7

tizcitert ft,41-8 ia7 W-417 3117 ti<r)(.4 trifffi 4T1.-11;

(10 wiT4 .ER-irit41 fq f1i1z ftir AFT -ip-A-4.1 A

,m;FifOtr% TrAcM arcr;

--0 3.1R4 A-Tr 4, 1- 411 fai:81:4711 7RI

Sit N.P1-111n.., I V id. ) I

S

image7.tif

. ‘ m ‘ Qflfiflgnzsamkgmflnoa . r 3 midi fiafifiaflflmflflfifizgwfigfifig $3 fig: / a-.3‘~§m\n3¢§Emmmflwgflgmfififljgwma m3 .\ égfiafififimfiagégm%gfl_ b alcvfimlflammwwflaflgfiafimwflafigammyjflg fivfiflgifiafigwfigflflagzflafl W mflmfifimflfifiwflAifigfiaAfiflwfifig fi§fi3%fifigfi§%9fl%fl§%_ vafifiagfi§§fiflnfi%fififlamg. filimfigflmfiwmamgaaflfiagmwAfigsi figgaAaflfiafiflfimfiflafiwmmgag . Amlfiflfimfiwflggflflfimyaaaafifigiwflafififi afiqwfigifigflgfizafiwmmgfiflfl. Eflaqfia $.3Eflwfiififlmmmgflflflm3flgejfigmfi H29:"myvawflwflwflififlnflugwfllwwumgg. E was magi Em £33 94 an”. gym mg: 2a «@943 8:5 mamas $ gag £4; 33% «#4 mg 3%? «4W; Egafigfifiafigqfifimggmfi“wflfimfingflwm 333:5 Emagad mm Blammaflflu my 3% 5% my?! nfififi Ammvflzr ‘ fimvmwaflufifl 33%.. W Aflvflflflya... m Aflvgflflfl“ Ht, 332% m Agvnfiflflnfiah . M» fivgfififla.% m E g “a £33 3 a: ma afiafifl a 233 m gadyéas M 333.43 mm 4% a? “may 431/5me 33? g E5 9% maxim mama: A~vwm§w3§$dfl$$a§1flmfl§mflflflflfimflafim§ %%.QEET E 9mg my magma?» a? a: fi dfiflfi fl figs fia§mfiw§§§mfi€§$aafl§§mfia$fia§ Amvmflfimaafimfiamflufiuflmaaefifiafl iggflaflzfifiwfiflyflnfifl“ 9.Vflflfifiimw§3w&gflaflw§mwflaflm “ “$332133 . n Amvggflflfiflsfiyfifigmwmyéflf . gfim 2&2 _ 4:: E... in: 3:... _ <59...“

ti sthT 3.7111TR91 quid, 24 7, 2015 9

23-(1) q,id E43IR fci1kuni tIA1133( tul'td fkm-T0 6 I cpt <

4T41tibr-c tirt:Pi *tetc6 39-63:01 13-414-0 3th WiT4 VItamti 311R

‘11 IS W4 itfl

‘3cc1 Vki dt1 jd TM tI44R4 Thl 716-RI WM111

24-(1) REM 7131ER fareat-ergtt ThT ATI( /WPM 1lTh70 614II aft f4Thwif Thor crftER

3itR 3TE21thil

it it aitt-q •6(.1/2 ER factiatlicttu Thcl teTf5 trail it 33191-4

rritkrut trmt-ct•3 4-3711 ail-R .iticitt ct)4ft

(2) ffitrt rit3ER 15T tiott Titt4 TR:ful ii -caft 3t1/23 u33-41 tfax-ml 42co

1-A 7.171 a ?aft f4n4r \AN I

25-(1) fact( wRift, f4-Azt Trpral Itemm cot<-1 it fc itrafturr134 iM Mrrr

vg19 f14-rir a•ii

(2) racci IA1? 3t13 qc4tir1 ell- tat MT ThIZIT ut im

26-0) qult.4-1 4.)4 RYcatilciCi Th-T Wpi Mthvi-1 itt-RI 61911 61t ITU ffictlut

31e4tqff ot1/2 •if m 31-CRITE191 311R titiT .6619c1t ItrulTth faYafactictRI 3156T9 3-TraiT ITT

3TR1 TRAIT eweit 33941 imtLw 411

(2) Thahriti w1,4 4-1 nor( ,itet,t'i 33-c3z11 twcictD 31t? 31RI 31 di at3

ctit-44 kitIT f6f8U NAN I .

27-i14,14 1439-6. 14VI iRR ten Trittffl a113 t31/2 mfOnt 4,

qki;? RI fttz-4Z1laziit f[I1!1P1 Ettfk6 %01 owL rdi Yifaxua 31t( n3-1 tA

gl-t1 134 1%ft f4-4 vliq

28-0) nit rrftzre aarriwttit mitrlyt- q)RlIrt8f crt it rs trp.mi 4-11 eft

(2) iff 3alliTEM 31:Fe.T1 3111.9 t<6 gR zIT ft-R11 166-11 Met wa3ert 4-3 ticrta tg. aieTft-

(4) ffi 1kjrrz it trarnftzti 174-r 111141t-ii+14 1:R TI-01 faktr nq, 43 3T39 t39 fetelf 3117

(R3I) \ictcf 1444Riti it 34-i4t rm. fkgroa3W Pituctr, 3T-4-fct1/2 itt RI-4114"i We 1/4.71191. AR. ciffirnftdf 31/2 tfttiRicf 3TR4 1141tli 4641e1

fat; -01:1-41T Ort-11 31T6TAV

(ii) f3cifacticie4 33ftrneptftittftstftft TWRit 343 4-4-d3 3W3 tu9-41 rifte-RT4i;

(11) thracticitt 4 3Tann 3117 31-41 /16Tfal- 311R IMRE 9, co tui tt f?rpg 3it3 ‘3,1,41 rift-at;

(u) fqaftratt 331 4-r4va aitzrrrn 3h 3176 tifiq, Cr4 ITYTRaw ntut att cr4 rd324,1-71-m f= d/rm *A S'T

awar it ft'•fe Thrvf;

(q) qflittit 41 tar VM Wfit 31/2-afthm4 nIff, 4140 *17 211'4130Pclk ii3p-riftt 41 3117 31-grt-33-93-otw 484011h 31/2 33Rrikro wzr-a-44

tv; •

(u) ntwritzt (It 41 01 ziff S Th74

246 ItPil On Via-2011

ittwrzt Ttfiffit

tr&tir wftrft

ftraur-dzi 3r.1

St

qt3ffiztrril jet fitit 4 vein

image8.tif

wW'wwwmmmgémgeW@ g g g £9ng wmwwtsmbuwfimm gmaemmn) fmw' MWWWWWL¢W$WM fgmmmmnmmgm. MMMWEWEWWMMM&v ,M'Mwwfiuuenmmazewmmmm) fnfiewwwma 'mglmghguzhm-MMWWQARBJWM —2mm'gw&mm@mguwg mwwwfiwW$wfi$Wfi@ \ WM Iumngwm & mahbfllWfiEMMQIWEEAwmm—az 4 mega mug; V 5' wxgfi Inflawwg MSW? ‘ww Mafiawwmmmww&mamm 141% «EL gem wawmwwwmh‘wmhwm-u ' 'Imwwwwwmmk‘ wwwwzwmmahwmmmmawmw 'wlhfigewewme' mmflwwmflmwmgmw. i wanting Enamlmgmgmwnfinamngngwmwm—sz ,1 Immgagmwwwflwemmmwwwm \ 'I’ . Iwmnmmn : gw‘g‘é’ @WMéEMWEEMRM'WEQW’SZ ' ‘1 Immwwufiw \ @wwmwwgwwmwwww _ Iwwmwwmwmm 'I ma$mwgwmmwfiwwgmawmw awning; muggy] upmmgwgfifihawawgzwhlmm—W IuLgi. maawawmwfiaw.alm maMBAME) [ma wwww 3b najzzuemmwzuemmwmmwlwwm ' autumn twmgmmafinwmmwwm—sz 6 SLOZ Era vz “am magnum mgr: m war.

10 t3iW At7T 3171TETN°1 TIVE, 24 T. 2015

(31) 7117Pit T EYNI afrfortaztratt Aar fat- 4 • 44,A 4 vitt; et -1

therdA t ftA aart-rt tar sTAt- 01 t tzaTZ 5 ft6-4

7-11771 'Z11 tflq 771 444 iztP41 31ta 777 71 gittr;

wrIA-4c21 taitatzt) wtrA 47rFil;

(z) zwItt, fttatril, 3T17 3T71 ittfl faRtfizzil

4 WIWI ART;

(z) 34i)uartl, test3f - al. ikrifffitri. izrz4 atIR iritR) .

R3Na 7771;

(3) 365M1 7SZ1 31711717 71 74ft 77g7;

(a) fAtit, 7-- &1 3t7 3T71 tart to-A3A/Aw1iaR1TdzIl 3z-lt

72/F9T 777-

3t7 3771 rnr4zr t-im;

(140 fatairdA vOrt-rtkeE 3actiftAl A fki'6'a editiAt

sPzmitA;

att7 •

(a) R444.4 t aerA fairtz ftA trA ter ITT it

ZW 14,4) urt

7t-tA t (3) trd tem favairatt ftA crrRitrt 4.

tzt14zt Tra7 ;tted tzA

cu ft4 trf3fAti 4 7 'd1 taATA-411 -ff ftv-i4r4

m tA

tA tittr1 tiTrreda trftt-dA tra A altrt

tt--A

&am Ititt 3iti wR t-aa 4 -41-41 fet 74

-4 TR till Af341-4 rstr-c

(a) 40401 39111713T1 A 3!--14tz ft4 -ge A ,t-tarRea 3a.z gHt

't17 fakll ajltfll

fAfA-Ktz fit.441 qr44 wrt#T A crfklyi A izrow-1 t-et

ffle ftrofAv[F-44

ffat Etc-11 t4 3114z - 411 441/1 tregto 1'471 4

Rritt 344ra

ftat traftAz t-ztA A 3T -frAt4 rot TFIRrErro A

tirdcrem Trc Thtt

ttzttN-a t- RA A acrAl 3Teittl 7 fAtEt A a WA

-A-4) 4-e511 trfat tr4

t-RA ws-Ard tatz-170 ‘Ata zte4a

S NAT t \it

74711itTI 7T7W t 1

Nalits1 V&A 3Titt7trl 3i1R SI 7 3770 7 3147 TO

t;c3. alunazt trd

Trro Aiforz q--41-2) TAW, ftwA fAttaftra WWI

-z-AA t

qni

(q

tw iuTrtA, 3rAta :-

S A ITT-1 tcrAt 3117 - t-ft -FA A w9-4 wr4A-t43;

foaftargu 4 Till) tattrtil, ft- 44Ar 31fiq crATu1-4:r

31E4117

1:114777 71 red f4nit arm,

(7) iteTuf arri Attar miAram;

(a) il1. itterw. vrArtrt-t zwt tett fAittrths

-g--419 7771 3i)7

3771 31tei Thuifta tt-R-A1 3t1 crz-FT ft-A tar.) 3A-R 'cum

vittT

4) ft4) 4.tA ta-Atzt;

(z) fOttentli A Ziagri Aro:ms)8A311, it4), thuctill 3117

1111P1-144 5 ftlR 117/1 7_ff mlfAtitTot;

(10 34tki 11VIirt

treTh 311-

1177 777 71 WA;

(30) crt3113t 71 7t7R7 31771 tr4lo 1A-44, 1AEW‘t

317171174 tIVECRI ?keel trf 3fR t--v?

g;

(t) 1=4-4-ttzirta-A z4-r) Et) ftEtni tA;

24t, KPH Data I Vid.2015

image9.tif

“oz-11m l "“(1 Max “11: $911 1:1 19119 3 1121113 12 11111111921121 (12) igunwwwwwfigwwwmw ‘ LL19 122121131 131.35 1121151 1519-11: «3315 99.1129 19: 112112191 (13) €215 L911 Lei—‘9 H2“ 1119534125 1315131193 1395313113315: (1.1.) “.119.an 132 9123. 1111111 D15 g2 1311-1111111: ‘1‘: >119 11119.15 ma; 1121121311 @ 111961232111 91112319 11 1112112151215 (:3) 5121139 1:113 1:11“ 13%} k1 ;1 nmmgggwmewpugmgmmemmwfi 1%?! 1 1112 11%: 91211 11125152; 53151215, 139 1211—1111115 111112125 hum: (13) 5mm 1% 151L311 HF 1111318 (h) Hum M 1291119 1111 W411 mmmzawmwmmubewuemww 1 fwmwgmfiiwme—nmwwmwm 1“ ammuaahtmmmm 1 mgmwawmmwgw'wmmw 13119 ‘ 111-112 1:31:31“: 921 911,111 :1 11ma 31111291911 1111: 11119111119 11i—ei WWW - 1g19919m91511m 1 1% 192111129111 11111 13—1211

\irk At71 317fTSTRITT mild, 24 ‘7, 2015 11

taimffil ffi Thwa, 3rgrmr4 3ft warrmi ffi ffig am-41 iiar-4t

fa& 2Ta-mr4 ti aifiv ‘3.iffi fc fdxafaimeig waTia fW

31aR17 tiiciacb,4 ?arta q,'-ir,

t-A t1tnP4t 1=14-ffi 1=.7 Nvi A ztram àfA9-

0 *Alffi fAtiffaa 3t1T tritafkrai;

(2) WI -e00,T1Z1T9 1. 31-- 4A-4171 3Taf147, th-DP2q fAft-ca

mulnwra-rail afrz arRi idift ffit 7€47171;

(a) 3F-qiIevr&4f aiiR crif4wv41. frS 31--Arm fmga Thaini NIT

TtEr 4 t, Tim Trt-MA hTromThcir ffil 'fa;

(z) f1t 31RI PicimufAdtaff.iiciZI Steifbr acirf A TFR

aiciwp ITTA titcirlf aftv 41.04, ,

.(2) littef4, al:0144 31- : atiT TurTuilzr-ffif ft-4

a-0. 443,Aft-ffi;

.(14) 3TUTITIMI 311-Z 31R:f /WITT t4ia cif Thbf 4-#1 3TR:I

ThaFc-14 vr4 Affkaril gkr fro 7 t

30-(1) Iawctu Thci mfOw ifiiit 014 qft ffi MyrS aitft4 ffit

51g1.41 azii tA ft41-ffi It wrma WTI itt TN?? %WI 71011. vita fatta

fArar ffirAm 3AT P1 3TW iIt taw 4 ft4i8 tR e4-R ffitzfli

(2) TPA. aitr41 %ant ffi Tim ta 4)14 er, a-04w ME ffiTerfthiiii ffir

crwja

31-0) f4ratri-Fii m afrgel c cii4 14131g Sftattn ffi

&EN AAR fa“i ffirThl 3AT 59iJj TFAIthit l<sid .c4dlcfljnc S 34T41 3tYR 31E

wri iaif 4 co4 Enr. Art ffi zifOffi ti M1, wuzli

wet I

(2) wrillaff Rite ffi UZI zff S i9 iffi 4,14 •af3ira Affur Tifta 4,18 atiR 'ffiffiOtifii 0 lv,r1-471)

. (3) w,ffintiftt Wft LW trnaTi WM 3N chid ITRER

ciltif W4-71 3N Old 1:fft147 gkf TilZei)cfri foa ritTS -Liztuvr

c.t)) Taaftirt L.R7m ffi-Mtlt aftv a 911Ø &IA 4 , (t, uliattr

32-(1) rereatrati ;IT* t4tipl f3f4-441 ffi ffi &law f4saa wiartial %la .04m/014 ER eimz.n au'

(2) faci1at4ciii itec•Th fkgaa fffi-01 t4tir ffi rita arffi es--41 Ita-r4 qp4fZi ffil MI& -14,4r ffirArtr. fkkvi ffi R-rfffi Wivr Tut

wermItiI5I 31-43R IRFT crkAS 4Yt1ld Itaqr< Th-T f:Si:47W1

(3). wf4a- cwicua S .arram ftffi- T-arft aftliffi ffiR

Trffiat t

(4) 3W41* W4 t. 3TTETR ch TIT 3TTWItW 311t1R IR

fkRi) wriat ffi Tnam -4 fW-41 fama ffil Trait 30 \31-10 facAsvii .watrft glt ittIf Zdiff I •

(5) ,ffi;ffi-LA ffi zirew m-10-a cr) Ortff ffil 31111a Th7 f t A-4 ffiltffi A cr2ciffWa ffii fai=429-o straii elm AR ffi;d-rfAat iu Mftzvzi RA TrZ) MITA tfr 31W7c4 Tht4 ZIR WA mialeizi A Tifflia 9 ftw 6141

33--(1). ft-41 atm 5 fkg cr-,1 um al ffiraRil fffitRot 917. 7-1241 ffk ftt1T

11RICC,11TT (414 al titan f)q•-*,t, ffi 3Tft71 111 ticbccf I1 1AT-oft-cif-ail ti

711i11459 VI 311 firm Trai afrR fffiTT-0 toi a S ffi fcit7 ftraft-efiffi-ii

a Ritz

z111445 *7311

aita wet zbi 3aTh-R

- -

Oatn. I Vid..2015

image10.tif

1.1123111»: L42 1:142 121m @1121: 1111mm ma sewn 21141111 11 natwéaweapnmeschwwmwmmm111121111111. gamnagmémmmmauegemmguaghmmmgfiggh 1mg; gmgmm1ma1g11pmzemmggeha1¢ IIRQLMM) . Iwmghm1wutwmw1mmfmuw wmgmwwwwmwwwfl1mwg maeamgnghweiegmmammmmmmgghfiw 1_ \ Wall—Wm: meawwan§wmaew1M$mem$ wmwmwmmhbmmgmwm lam uew1ea1nwmea m~$wwwm,_<c) IMMQQPJEEW$MWMEQWML $%%a%%$%111m'mmmm%agzs1aa%%%mmw wmm$wwwmammmwmma tummznm/mmalmg 111111211M11mewmw1m 'UWWfiWMBWMLfiQMEBW 115%le mwmgwwwmwmeM1M 1. 11%ghwb1wufi1emwwhh1aewnmwwmeu‘ ,Iu..¢ua1gnai‘ange @nmfi‘w MESH 11121111211111 12%th 11115112311111 mummy 1121111112) I gum: wggmwgpwmgeamJ-hpa'zlbmhgagwggnmwy: wwW$mmwmwwwwawm1m wmaazmthQEthmmwzmmgm—w ' Imam aWwwewwmsawwmm - Iwmmm1mwewmwmm mm‘mmmwmmwmemebwmuw wwwwm$wmawwwwmam Iakmmwmw‘wm mmmmwmww1smwmmm . fwulhkaw 12% M121%11n% 1119 112121111 we '1%11Lite '1%111\ (2), ' $m1mwa1i$wwmmmww® fwwwwzuemmmga'aucm wriwuéqwm mm 1119 wmmwmm) ' ‘menwamwww 21111121 MWWW 1212an 1%12mram2) - wwwmgeww waémwm1wunm$m 12111121111111) fmagggegmngmm mmwmgmmgmgwmwgwmmmmm wwww$mwmmw12m® 9102 Eh va/aau W 11;}: LEE 71:» “(.7 1.7.74.1:— 4.1;;

RPH flhIL IVjd-tlili

36-17T 3Tfill-TRI11 1154d, 24 2015 17

ifflfi att7 efrrN

gitwftu'l 3413 fel45Rif

i1ft2 14-irc

1-Tqi

TRI7161 Thrl 317R1

'ftrufe-ard-n 31f4-thlrEM arRisp4rPrd

9-1W4e;41 aT`N amitsft m-r SIM-1717

R-ur-fr f4lt

€191-4 '1*-)

mar Ertrurat 4 RP:41'6T 51 t TM) ET). 311[9 61 r an-s4 4-1- 4R)

a<pck-r mar crit mc1 Rnr f4-4tt Rrr -f6f0m iT)ur 4 4-2P Thift,

e iiq,iRIf irr Rpirfrad- inth fiaftz-q4 m-sr 4-6-et t f64 <t),6L4ft- cpi

3011-6- acnor t

(2) cp,q1411.1 6 pa ftTZIT Jiiir 31ff9 6 111

34-fraftriall 31-4A 04T4iReil ;13 fk tit tit taP4-01 -srat

349 , *a 4,14 *94 gigr 31-4e .07ft qY15-1 ZIT chc-14T17FtTa1 71)-TTIT 7T1 znuff*

110-1 ctnT TM-cif t, Rt--6-9-r3t- mat au Th7 .elch311 t, ulTr cr,id zrfai-4

g-1-71 fkNhi fawr ..114 1

35-,* e4T-TT ch)g -3149 37,11-9 6) it tin unT fty4favir44- ft-itr

crarm-rt Zn 3177) fki5izj ttit iro-rjwq, wzr 4tfirn- Zn er firr nth t

4t .3.6451 iT 51.1 t \i1 •unc1 45 T,1141:11% fWce: ft-41-

itracbr ‘3i1 -ratio A 1. flRiv.4 aift4 tlirr

36-‘451 ffitratIlc14 r+741 III 451 ch 31-1419117TznzIRPTZPII

349 ,t-P1411'4-ziwr Th't vre4T tiiflt 3 TT

13R4-rir, iwRir zrnmit eqi-a 31-R:r urr4?[, it* miftwrtim=wig?

4uffiviL 011

37--facnencd4 wrfnilt ZIT 31-R4 flTh7-7/ 31-6T+ZI) (ult9 TE6.1-11.

1:14 PZ1711 ite4W1) m-sr anu 41- TRr ftikit w•R Ttizr‘r fu'r•i

Reim It4Tr gq ftg-gyrif 1cl irr a5e411:1cr th5IlT 1-1 ftgaT

31* Thr) *SI 3T-d-M Au- 4Ri -ril-Trr I

38--Itsarr-Fir FITTh-Tat ZIT 3Tqf fifTTZI m45.1 cpi4ciil

ui* RTT1 4 It-ift ft-4T irr faiiirl It 144,11.-mr 4i1.4 45N14 31Itft9FIT 91,9 zPir

39- envidir ft-Rt 70-m-rt zit mat Wit 7-01-4, 341TaT6-9,

chi irr 3T94 6*c1iaul, 3fIfci1411(9-4 31T1KIT-74 A -A i5 ZTI ctica

mi spiffuro itZn giAr i th t{t nch11. 341-Tat4T, 9.31-4qT61, Zfl-

cT-t-IIaks1 4 -Oa t1 IfQ,151i3C111 ZITO W14 4 14614 rOTTIT

5711-4711 aii4 3i-fitter f4trir 30 0446kM .T.1a514 W3I 4 -1/619 thRTT WZ)711

40---(1) -1-.F1 &WIWI q:). 349 TTRIT 7RIT 1Tt ReHim Z11 31allV -16-NT

tcr B4-6--ea m-uur -t-r-4-Trr

(2) TO 3arH-1114 310t9 Rif uffa1/9 ZIT 3Tallt3T TETT

31TRTWitt kr t1r4 7T4 1T1 z121121TA VrdcvI it-tr t-r4-1rr I

41-(1) T4Y11-atIld1.1 f414 arritri MTTcNl Ett b-Clt Thr 314) - -2-1-111)

far 7-2-TifeM coiAir 30 Rprir *1'2 chK Thni I $€ 1* Thai '1,C4

zRR-rit t ER 34-5-13T -161 ft7LIT .7r-iltrr I

f4.44-1Thur-6-4 RP-Trzt It--44-0 fI1 1I IRt t tRflt-p-

It-at coi.1 tar tfaT

fai rthou ipi-wir !tit t Zn .114-T1T+1 .1=411 t C T91ft .7Q-T4 th;7-fRi

cni cpcir t

119.RT (1) A fafliard z/9-aft 31frc5 319TCP1 thra-avat

t fa-4 f4-k-4faskiel gri-r tut itRuT -11r -0 f•Ichi(41 iT 'Ri-,1,41r 1

42-(1) 1r4$11EIT5TTZT imir•zr fTM 4t 3.-P-1WI9T cbIfl lrw ft-ritMti-d tNiti

‘7Trr mar tlirrt, apaia--

(t) -T41 7-f- 1 a faRcrfacpcdu mcPrifizt ftt- ;

1 0,5

image11.tif

wk»,- , I" 7 , tn: .3 ,3, a“ 4a.»?flatw : ft, Maw: ’ wwhakawwwkmfigem , ' ,- .» $19”W1?*=V— “HEEEE Em Eng ”Egafig ifiam €15 an E5 m w 5:5 5% E FE E5 g NE HE; E 31% _£§EE®@£EWEEEELRQEWE§$ Ema E wfifimfiflw flEum wEmFWEflflwE E253 .mfiwwvfiwflgfifla ESE EVW&_EE®@£EE¢QEEE&3 Epfimflwrfiwmmgfl .Efirfimflflgggfiwfiaflififlfigfigg .mfiwfififiwégwfifig Pfigfifiawafisfifiggfigggafi figfivfifipwfimgggfimgflflwmmmgm 3|: _EEE€E§%EEEE§ Efifiuflsfififigfiflugfifiwrfiafigfifi _EEEEEWWE Efiwfiaafi Ema”? BEERlErmrfim figflmfi 33:2 :_A:55&EKE%EE%E%EMEEE%6E 5&_E¢EWEEEEEG%Q§_MESEVE?” 5 En 653$ fits .va FEE E? g E m E: E 55:3 EM EMEED ewfifiaicgfiflumflfiflfifiwfiwgfigfimfiw .Efigvffiafigwagagwfifigfié ELM @Eggwggfifimflcfifigmfifiwfig Efififimfifiggfiégfigfllg _EEo%wwwfiwv£fi@§wwfiaggfiamsfifiw sEEEEEEEEEEEEsEEMUMEE patefifiwwwwbrwfiwfipfififimflagfigtafimwwffi @fifikwEEfiEfifigEEfiEfiEflts Ermfiwwmflba Egpfiwzwgfiwfifififififiwfiggggwfia fiEuEEEEEEWEEEIS _EMEEE%¢EE_EW_§5 EflwmflfimfiuatmmmfiEfifimzfimgwfigwggfi Tgfifimwmflfimfiwggénfiwfigfiwgfimfifififla pvé % ”WEE EB mam 5w & rm Him is MEN Ea awamm _E._E:EEEM EaaE_ngKm§%§wfifigg«Elfiwgwmrfi @fiagSEEEEEgEEEEEEPmEFg “Ewfiwwfiwgfiwuéfiwfifigfigggfiaig _E£EE&EEEEEE _MEE% EEENEMNE fi§w&%EBE% .ga.grgggfiggfififigfifiufig ”7y 5 Evin ”E Em rEo An 5: Eva £23 @% 55:15rtmfirwb fi mam Ev «N NE: BEE», Eu» Ev (.303). _ 5: :ax a? 0E WEE Egg FREE 5 Eng go 35%. mt.» "a. t. .u. Emtznfis Em Ebmg WEE 5, T E am E5 EEK? Ema w E $ E: ”m EEE Em fiagfi E g ease: E

ttredrzwa fdErui

TrkW 313iTt1Tr1 'quid. 24 3JJ. 2015 13

. (w) fs-Rit 31W4 01-T1 9-4) WRTI1T;

(9) -01:41Pr gt4 Wa 94 A-41 atru-419; at

(a)t-A1ai u:rer i flT krfa 4--ffr94 WrIfSA1 3T1 Thf0- gt4 Thftg ft-TIT zruT -oti Th-film•ffst 9-4 A-41 *RN

(2) tntn-4 1414 A 41-Trt 4-91ftr tmvcrzUrr foaTh-ark-a .041 arradf apff fq 1=4-4r 71.??Frr

43-0) ffiew çftTh-re fklb TaTTRa. ch 41 Th-rifkfto 4-9-4-ft vPir Thcl vr-4421 3TaT14:-

(s) Ths-1-0 !J 3ñ truit34 D)zu

(11)Parafttific9Q 4-zriymi ftie .W41 3R1 •it d MCI St ,141 ARAT 49-911;

(9) 0-d 5N1 ft?) "'i1-4 041 3isT419;

(4) %--‘41 apzr u<Tf=44 zn ffrouzt gRr MIA fTh-it 301 NO gpo Mft9 Run- 94T 0; ott ThfiTm Thrti A-4) att4T4T-9;

M f4-- T-A NO- vRT 941 *mid arm t

(2) faTh-TRT rat A ti<T4-flit4 9R 71:11 /1111 EFTRift. Th7 UtTzfrir fated-CAT-QM fatitt fTh7-11- v1H1.11T I

44-t1171 41, 42 Sr4 43 311}119. T2ATfefff fAitth Th7 71111 t09Inti TAIT 3ifq 3Taff .<0 fel-4144 3117 1--1-444 tut. w4-4-r 3171V7

VIRE I

457ffitigia VI 3.MT \LI'M'i 3121.01 •9y4 \t“or? WITfit-N1th9 fti01-zi 311R f4?:(711119 eTht1 3r-41 Ths-ra air 1161z1011<hi 3121Th Wit

+101Thif 4r4 Ottri

46-fe149 *nits s-rzfsul S - 1W4 4A-04 Ji dcli'lq Yr( 1t4zil ariAT5_14T 1.4-fTT. VetTh Thrl tite4.11 -1:11" 3149. A ,?tgf u1I+)01 I

• 47A1) ft/eau-ea 312T0T farefF611 Witt warflt ZIT ThT Mt, '011:1 fiiifWelleftf aT2Tvr fta---Azt - atk aTT-4 cbidomoU A -01-4.4a ‘1491311 4r Ak-ol1 rep st 61.211 r4i TU-9 vlig I

'(2) TRThlW 1•Ift1 "q0. t•fl 3TRiftzTri 3124-41 14R1)491' Zfr 31allte 311-Q 3critfrf* 3TtftflT5i 3itirff faYciftl ti4 kra.

runstm 3T1474 i'it I

'48-(1) tift ft fhan331tT4libffkl-Fr-9 ftftztrfira 0,44 40 faRr arTuR 31'T1. fattest 5T IT-t71ZI ch'401 '<kit! 11.20H 15B Wri R<tftrd .41ft-0 ku-ri •

f4snti frf.0

(2) atii*,...(1) Thfli.tz 141?-4 ft-tirs'A :3117 wet cut, '34:11T0 •aiwk ftaTui 10644sbia "1-02.11 ij4-Arf,ft4 St -GIRT

49-(1) Fri:(413 t 34117 .ftrafturkzt 44IT-A4 f4sTA.T4Rt•ffs-ir ‘TztuT I

tre-ff ART )A- w 'fl tNet)H MT-at-am-4 tWatitr4 fair 1.110442411 11 WM sr

zEr 9s7k fh-Qratnet4 uzutfrr S1 tilt

faraltarku sr a 409 q4 t3T410- <•4 4T4 ml cpfW-TTZ11 fw Pa( 4191-<5 ifiRt zu

image12.tif

4 ‘l m rear WW“! 1m, 24 cm 2015 1 ,- ,(E)finfiamuhfimafimmmm; “r (wmammwmmmm ~ (ayfirmmwfimmfiifimmfiIfiammfimfimfim {1" mfimammawfifia-mnfiwfiml f‘ (nmfiffirfimmwfirmmnfimfimfiwfimwfifi - WWW: 43_(1)'%mmwmmmwmamwwm amm- Wmafimfiwfiquia— (afimmlwaima’ffimfiafimmmé; (wfimffiwraufiffizfimaEmfifiiifimmmfififim finfimfimfir; (11) W m Rm”: in) M (#313171; . 1 i (u)%mmwfifimmjuzfirfimmuqa%fimfim mfilfizwfimwfixwfifiafirfinfiwfimwfi? (ejwmfiwmfiféfimfinfiwml ,, (2)mmfim-Wmmrfimmfimmw—fiwfiarfl fifimzfifiqfifimm'm ' ‘ ’ -:‘44—m41,42qfi433§3mfi=rwrfiafifimafiwa§w may wammmmfimmammaammmmmm WET“! mmmm; " ' . " aseffisafifimu vmmammwfiwmzfia Wslfi qhfifiammwfinfimfimawfivmfiffiflflmwamfififi mm$mmafiam ~ _ , '46—fiflfifiifififimfi'mflmfififlfifiwgfiwifi gan- fiwfiymmfiwgfififimfiwmefiwfimml - , ,;4zfi(1)fasafammwfi§afima§finfimmm3®maflua “ha“??? arrfw 31m 13> as Rafa-am?) mm 3mm f‘afifiu'sfiv mmfimfi'fi m?“ F‘ifim‘fimafiuraméuTmfiufiaafifiwfismwmmmafifim m? :(2)imzmm ufé a1: mam? %3§ffifimamqfifiufiurmr€sfi $Wfimafim§wémwm51$mfiwfiamafi®mm "Wwaéfima’smwml ' “'48—(1)ufifiwfimmaqémafivfi7mzfififiufia ammm W ‘33mmmfifimmmwméafifimmfimfimfiw “(mm mmmmma‘m- ' .(ZIBfiHfiTJ'oWfifi‘Emfimfimefisafiamfi flamzs'fiwvasmmmammammmfimrm 'Wfifl-m-‘fiqummafiwfimafiwfiamzfimfim 49‘(1)§1fi'9d§®asfiqfiwfiammmfbawwmafima§w ma ”WEEffifimmmmfiwfifamfimm am \ 1; V . t > 1' l3

246 RPH Data I Vid-2015

I .1

14 La71- 3TRiTTR171 TTIR, 24 TV, 2015

5 NI ib4fttiTF-ra

clNii

ethai

(2) TIT ‘3LIZTRI (1) -4 ThirW thy-0 UTNT taRT tigUI cRA -4;

iThi-41tvra-zr aitr 4,1 to ctro1* f&T-1 1I14RT -la a a i-NMR gpo

aro f tt1uei RTrnif-ffzil TT Ziffiain; TT Pi-t-IN11 aNcii TOT itt

50-- (1) ‘161 •ii•TO tra-R 17) ti-1 3I1lizT41 \3ti64 3Flen

cm tii4ET Qichizid t a Cl6 it'iTf1-07611 i1 ita/11cf Mnt

1-1Trr itraltarFtr afer69 ratit 9t thitr Aluz zth Art

TO Wl-Fri, own 6-thrq ft l'zcacric.rzr critter -# 9941

3TTNT (1) M 3147 t afet 1:17 11YORWirti4 MT ‘ick-N STIWr -111

IR R - 1-a:f tra711 mtliTZTT ffiremar-0-4 Th-ro A AP-ITITZTT

3TRIft17 .Jtrcitil Te-rcriE9 t3T 9Ijcl1 tutu TRH t thr t41 u1rT4 3Tlat

1=-0. 46 a Tilla

3-TZTTRT (2) a 31t9 utiti it vzf5T9 ,-1•<cf)K 3TrWirI9T

gN1 I ITItatt a TT fra-z1) 3n-ra-t varra-rt ra)

t antan ftzrovr rat911

-31-4TT7T (3) 31-1I9 3Tfl15T1 1I aalt '4 0

alitftiPTi 3401•T 310 cFri cp,“)• 3T1TTT ftftel Wit-41 'tftclf, 1908 a

3T1t9 fiwñ TITmr ftWIZt:, 1,)4 911- cr ffirMI ti4ut fo'6RuT ecrrA ftn-F

.41T1-517Z ZIlat at, 3T241:--

(a) fat) TTI8T1 z il41.4 Tiff' 34N ‘311R2id br‘T f --21 zno-T 4T9r 6417

711-T2T 4/1-1 c)11;

(tf) ftfIT 1*111‘if ektritri 3TT' Sfeiff 1-N,)cit ar:159 -M\FT- T;

(Tr) era-R:1r ra-Rriwr f+-zi) dlcr, an'd-ur tn. vn ranr TzErr

CEO WET2T-TT TTR TETI TPt 4,N1I-; aT17

(3') clU 31-41 irproir fIt itftu fra-m uncr

zrik ttr RtfrJ CITTt try IVO ' -Nct)H aT WITT1T Ulla fa.

thY1 31W4TIT MT ‘Icre-it4-1 faTT t a 46- f4c41-4nclz4 161 f."fh., t41 ffi 3IT17T4' lyTTR. 3117 nr aTf4f499 \3,440 t iIr 1-zir,gir9

31-trr6- t

Li arra fat ulicliti ffl-`4T vid AePIIclk eki $11'{ 1 3Tf4ftT7T

M rar ‘3mitm fra-zrr t ,<1,zr thdcw, fZqaet ara AT

t Rzcrfacriew zrt cokui 6-thrk Zieffff ari tat t f5 zrzil

t1(71i4 Mcf I18-1 Of c1iM4 l alltI I ratan-COT it \3471 ‘icc1-1 Mei TTR1 tr -

inc tNch-TR (4)1ZIB 91I1ETT9 t 1/431111 t it 9tI 3TilififTT it iTt#TI A24-q-i-Ecar

scctH ml ArTz-&-r cr-rth t th -6t itTlfTWI-621 31-1-4TT 3T7871 it TKei 3FTTITT

YIN1474 Tiic 4 crcTirtim artr+Fth gTR1 fatiTft77-1 1ITR-1 tibt) t

-014tRI (6) it 3Tt9 faTaTTetii T4-4--t itt 3T-41 RT-‘51A ,z•NchR

t-TRn 16;zrre {Ark zwnyzi f9f?( zn f6raim ft* in 99-thr9 fszrfaumzr ct

raiacric•INI mw-,4 ,crath9) it ftt cpir TrtA1, itTerften 6.?1 ffiRrzrr,

focil)?..neio alerWa- 7rzr rai crk.1 zr9n •ffa:r WMT

tkt aRt fr rT. r1Y4stiotritt iRci4i zur -Rtmosr cr) ticr.1411

(8) 317TTRT (6) a 31tt SITkM 3TTkRIT9T Thx ItTIT M* *1111' a

3.1-95 li,zn-trzFr 96t91

51- *Nati •04-14 zrz fared-triazi i15t t tRr f0-qqct, M,Isf

cb 'do& e aniAzrii icr4z.T1 tr 31-fin 9 cw 341tilla 3-NIT I •Qt 1=4-a-Tr tr 31-I9r-g9 Rcif6triercr fra-thr 9719r, .‘ar 9 4"t r7 rak

lt wra--th t 1 zifaviclzr qacr cri

image13.tif

, W, F E agfigfimfimgfigfi WU, EEEEwE.EEEEEEEE£ ”VZEVEREMWEEWEWfiEZmEfiEKEmfgmm Efiggwflggfiwgflflgflggéwrwgglrm .EfiwfiwEWEEEE wEEwEEeggfiwfiEgEa éfiwaEEEEEEfiEEEEEE EKfiEEfimfiwvfigfigfififiéwEfi Ea an Egg %_E% Ew FEE.“ E w EEK aw wmfiflfifl FEE mm ea EE 5 ea E5; Ea Egg 653% :55. WE EXAM Mn 52% am 3% ”w Ewfiflwfl E?» my“. @ 95%. E _mfi&waE%Emg Eu FREE céfibruéh EEK wfiéfifirgégafiflgfimgfiirgg EMF; EN 3.3mm» Earn aw mflmis G :me mag 25% may Kgfiwfimgfigfiefimwawémfimgfigrfigflfifl rfimfimggzfizfifigggfigéfifiwfimw EHEEEE%fiEg_EEfimEEEE$ Eagmfiggggmgmfifimfimgfimsaig Effigfifiwpwggmwfifleafiéfigmngfi ficrwfiwfifiw Emmfimggfimgéwggfl éEfifiEEEmeNEEEEEfiEEflwE .Egmflflgggwfifiv Kb, NEWSWEEK «3.35 E wififififififiswwfiwfigwgficfifi WEEEh/mrfigmmggosgfifiufififiwfigfiv NEWEEEWENE €56. Bfiwfiflm «Egg 1% 5% Ewfirfim Fauna E A AEEm .cfim WEE an ELLE? THE E «Kw szmé .r 3,1.wa WEE 5% SEE Em NE avé fig Wm 82 :ME. SHE 5% any E FEE mm #59 «a» £55 «9, Eat» E. E £55 a E5 E5 E Ema 5% w 3 BE 3 _EEEEM~E5%EB%$E wfiwummwggsfimfififiefifiggwgfigfigg Egzégfifigfififimgfiéfiaéa ‘ _EE%EE gmiggs Emmfimfi:§u€:5§§kmfifigmwgfifla Klggurgfigfigfiéfifiggmbg EEfiFEEE Egéwwrfirfisfievgmfi E?» E: bucuvpfiasgwg my figs Eg¢w5,aawwflwmcf£u ampafiafiawfiefiegrmmggfiamfizfiwwfiwgw Eewfiwfiswfiéfifigfifiggfisé EEyEErBEEEEEEErfiEflQEflE EEEEEmfifigfiwEEEEEEEEN "WEN ESE Eflfiwgséfia Ea KNEE; 95% an E |||l||l|||ll||l|||llllllullin mam Em «N NE: _EEE@EE Em Ebfiwwamwrgan nWfiflmwflfiEEEfifiw. m_o~.u_> _ Sun— :eE can ,Ewfifiw EEKE Egg «NEEE EEMV FEE WEBER? EEHHE EMEE E

\ic-N stht 31711ZI1TII Trae, 24 Tip, 2015 15

52-31 PIW-11 ‘31LN zitcftga fraAl utr- 347 1t4e4-£11-dil Thtx9.f4nyv1nnmi

Nit A raftErr-dif A iiwfa Sit st jltriAir4l f4tw-fi ft4, rq B.1-4 IR

Thf0 zrr ,t4 arR:r NO- tiri-Act t 721T ffipffitheitt dITMptt 344-10u tiftfral/ 7R1-111

wc-R,

53-(1) 1.•)tf it<OK tfT1 ffi-41 Tht6911 31171 •<I‘rt1 tit:PH ata7TO 7

faearall 3TffiedlITT, 1973 Wrect 3.1ffiffill11 3EFeal tist)4-114 31"tT tb--

A 7 ra4;r4 wzit-AATet fkhr t TrAil fra zaraf zqw4T r-41 rarara14 vfikr A A- arta A fatte A Lino. AmlraTe, Al 1 3itiM '<6a totizb-R. Tlfrat9 TH t W:1 ef 1:31-1 317011 TIT TI4'k1I9 tHIA writ 614:

fra aifONA ra 3TE(12H .04 trzqm till co arifti Aftfnzi raRtiri

\i-vaRf 0.#, 3419 1-4,741 TRIT 311t1 MKilik 71Q.ntill

,(11/41-0 ffitTr9 41u.Sei c141TRAI* TPlaf .<tg I &PIT I

WERTRI (1) 3ffitff ffit it fbr 3TheTT wi ffirit 3T1tIR

31-RIf * ffii ch14 Thf69-14. a41 ‘3LNio fez t, ttiTir9

Aff eft imw ‘3-101 4r<11 areS Wei 211 I

3-caWi 3ft7 chkul

‘3=4 &r,1 A A Li 111 IA acjIrM cm4 3417 flA Troufitaf ITITFit-ff ctr<• ‘Jvci ttulaccif cna 3TE21717 wf ufticruf ml-Ruro raw') 3ft7 "ffitd71.L1eW4

tt ftf-W4WI 12S-CIT t M58U M 111 teiiu 1,;veiYI R1*1-07, 8}nrnt 3ñ

el -tilt{ Min 1882 311Th9 *4zt-f *FITAltd t, MILIIffiThf At014-10 ffiMffiE:f1RZI

rIc4>16i<11-4.. fratilow. ‘ickv Ilt7T wra afurFF faxaRtilow Tztriem 3t17 firrl-Au fraw urfra aTurrcrA 7m3Sr ati-f tIQoct UrNTiM Thra-Fr wq-wra-Al Trikwft,

afrz slier A 751 S Alum arrawrra clic-1mq aN Tiftwq RwA ttw tIcl/ I

cleVy( t0crii0 Rxciratlietu ‘icchf Ilt4T fb}.lt-ra, 2015 37RE.I1ffiii ffil.1T t I

31-1gf

aii R,

SPF .RiRct

No. 645(2)/LXXIX-V-1-15-1(ka)13-2015 Dated Luclaww, June 24, 2015

IN pursuance of the provisions of clause (3) of Article 348 of the Constitution of India, the Governor is pleaied to order the publication of the following English translation of the J.S. Vishwavidyalaya Shikhobad,

Firozabad, Uttar Pradesh Adhiniyam. 2015 (Uttar Pradesh Adhiniyam Sankhya 7 of 2015) as passed by the Uttar

Pradesh Legislature and assented to by the Governor on June 23, 2015

THE J.S. UNIVERSITY SHIKOHABAD, FIROZABAD, UTTAR PRADESH ACT, 2015

(U. P. Act no. 7 of 2015)

[As passed by the Uttar Pradesh Legislature] AN ,

ACT

, to establish and incorporate a teaching University at Shikohabad in district

Firozabad of Uttar Pradesh sponsored by Shri Jagdish Jan Kalyan Educational Trust,

Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Must

Act, i882 and to provide for matters connected therewith or incidental thereto.

IT IS HEREBY enacted in the Sixty-sixth Year of the Republic of India as

follows

I, This Act may be called the J.S. University Shikohabad, Firozabad, Uttar

Pradesh Act,*:20 is.

Shop title

image14.tif

111111111131111211111111111241514015 v , '15 524W 11 m Emma 1111111 11178 21‘: 3121111 1121111111111 1151 $211711. WFI/‘Inflxgll $fiafi1fifiwfiwfiwmmfiafiafisamfiuimfiwrmmmfim 1111111111 mfilfimafiémfifififfim‘é, mmgfimuzfiarffifigwfimfia “WWW 113111111 ‘ WWW 53—(1)WWWWWWIWIWJ§¥TWW mfiwrévfiqg WWAQ73$€W11WHW1$WH1WW$WH Wafi fiegwfizfinmmdusfiénémfiswamfimfimmmfikmfi 11111311111111W261m,fi1131§1fi=11%312fi11€11 111111131111121711‘ Wmmufimfisrmaswmmfim,mnmfifi2 211:. musffissvamfiwfiwmzfimfifiadzfiqmfimnfié 31111111191137111 1111111111 (2) 111121111 (1) 1‘» 3121111 92111171111911.1113 311111 W 11111: 111111 2121111111 mfiw1m$a1=fimn1$ma1mmfimt (3)mm(1)11amnfifinfifififimwfinfiwmfiwm 31111111111411‘31111211111111515‘25111113‘ Mmfififieafin’éfiw afimawmgmafifiawfimt WWW - memeeafiammqmaawfiammfimmfiwmrwuma Wamaamafimwmafiafiqmafimfifiamammwmfi ’gfiefiusfifisaufimnufifiwfiwmmmmw‘maew 131111111111 Wmmjfi 111—11111:me 1882111311h=11fii1§1$11 W" 111%, mmmfiowofisafimu Warm. 1117111112111 W9W$Wfiwmfimwfiaafi1fivfififimm ,mmwmwmmmmmemmafim 'mmmfimmfiwfiwwmgfimmefimmt 11111131 1101110 11121111111111 11mm, W11. W $1131 111213111 2015 31:13am 115111 11111111 311111 11, 31m 1111, 513111 11111111 No 645(2)/LXXlX-V-l-- l5-1(ka)l3-20]5 ' Dated LuL-lmaw. June 24, 2015 IN pursuance of the provisions ofclausc (3) of Article 348 of the Constitution of India. the Govemor is pleased to order the publication of the following English translation of the 1.5. Visliwavidyalaya Sltikhobad, Firouibad, Uttar Pradcsh Adhiniyam. 2015 (Uttar Pradesh Adhiniyam Sankliya 7 of 2015) as passed by the Uttar Pradesh Legislature and assented to by the Governor on June 23 2015 THEJS.UNl\’lERSI'IYSI-llKOI-,1ABAD lfllROZABAD UTTAR PRADESH ACT 2015 (U. P. Actno. 7of2015) [As passer! by the Uttar Pradesh Legislature] AN ACT , . to establish and incorporate a teaching University at Shikoltabad in district F irozabad of Uttar Pradesh sponsored by Shri Jagdisli Jan Kalyan Educational Trust, Shikolmbad-Ft‘rozabad a 'not for profit' Trust registered under the Indian Trust Act,]882 fl’T’d to provide for matters connected therewith arlincidental theretoi IT IS HEREBY enacted in the Sixty-sixth Year of the Republic of India as follows:— , . i . LThis Act may be called the 1.51 University Shikohabad. Firozabad- ”"2“ 5"°““”“ l’rad-esh Act,'320151

. •I

16 Mt1 31TIPTITIT -9-ME, 24‘1-9., 2015

Dclinitions 2.-In this Act, unless the context otherwise requires,-

"Academic Council" means the Academic Council of the University;

"Board" means the Board of Studies and the Planning Board, or any

other Board of the University;

"Chancellor", "Pro-Chancellor", " Vice-Chancellor" and "Pro-Vice-

Chancellor" means respectively the "Chancellor", the "Pro-Chancellor" the

"Vice-Chancellor" the "Pro-Vice-Chancellor" of the University;

"Court" means the Court of the University;

"Director/Principal" means the Head of an "Institution". a College,

Centre and School, or the person appointed for the purpose to act as such in his

absence:

"Department" means a Department of Studies and includes a Centre

of Studies and Research;

"Employee" means any person appointed by the University, and

includes a teacher or any other member of the staff of the University;

"Executive Council" means the Executive Council of the University;

"Existing College" means a college or an institution which imparts

professional education and is proposed to be merged, run and maintained by the

University;

(I) "Faculty" means a Faculty of the University;

(k) "Hostel- means Scholar/Students Hostel of the University;

(1) "Institution/College" means a college including existing college or an

Institution established or maintained by or associated to or constituent of the

University in accordance with this Act and the Statutes.

(m)"Prescribed" means prescribed by Statutes;

"Records and Publications" means the Records and Publications of

the University;

"Regulatory Body" means the statutory bodies established by the

Central Government from time to time such as University Grants Commission

and includes the All India Council for Technical Education, the Bar Council of

India. the Distance Education Council, thc Dental Council of India, the Indian

Nursing Council. the Medical Council of India, the National Council for

Teacher Education, Central Council for Indian Medicine, the Pharmacy Council

of India.

"Statutes" and "Ordinances" means respectively, the Statutes and the

Ordinances ofthe University for the time being in force;

"Student" means a student enrolled in the register of the University:

"Teacher of the University" means Professors, Associate Professors,

Assistant Professors, and such other persons as may be appointed for imparting

education instructions, or conducting research in the University and are

designated as Teachers by the Ordinances;

"Treasure?', "Registrar", "Deputy Registrar", "Finance Officer",

Controller of Examinations", "Librarian", or "Proctor" means respectively the -

Treasurer. the Registrar, the Deputy Registrar, the Finance Officer, the

Controller of Examinations, the Librarian or the Proctor of the University;

246 RN I Data 1 Vie-2015

image15.tif

16 am new 31mm m .24 Gift, 2015 Definilions 2. -ln this Act. unless the context otherwise requires.- (a) “Academic Council“ means the Academic Council ofthc University; (b) “Board" means the Board of Studies and the Flaming Board, or any other Board of the University; ‘ (e) “Chancellor". “ProvChancellor”, “ Vice-Chancellor" and “l’ro~Vice- Chancellor" means respectively the “Chancellor", the “Pro-Chancellor“ the “Vice—Chancellor" the “Pro-Vice-Chancellor" of the University; (d) “Court" means the Conn of the University; (e) “Director/Principal" means the Head of an “Institution". a College. Centre and School. or the person appointed for the purpose to act as such in his absence: (0 “Department" means a Department of Studies and includes a Centre of Studies and Research; (g) “Employee“ means any person appointed by the University, and includes a teacher or any other member of the staiTof the University; (h) “Executive Council" means the Executive Council ofthe University; (i) “Existing College“ means a college or an institution which imparts professional education and is proposed to be merged. run and maintained by the University; I (j) “Faculty" means a Faculty of the University; (k) “Hostel" means Scholar/Students Hostel of the University; (1) “Institution/College” means a college including existing college or an institution established or maintained by or associated to or constituent of the University in accordance with this Act and the Statutes. V (m)“Prescribed“ means prescribed by Statutes; (n) “Records and Publications” means the Records and Publications of the University; I (0) “Regulatory Body" means the statutory bodies established by the Central Government from time to time such as University Grants Commission ’ and includesthe All lndia Council for Technical Education, the Bar Council of lndia. the DiSIance Education Council, the Dental Council of lndia,.the lndian Nursing Council. the Medical Council of India. the National Council for Teacher Education. Central Council for Indian Medicine, the Pharmacy Council of lndia, (p) “Statutes" and “Ordinances" means respectively, the Statutes and the ’ Ordinances 'of the University for the time being in force; (q) “Student" means a student emailed in the register ofthc'Univcrsity: (r) “Teacher of the University“ means Professors. Associate Professors. Assistant Professors. and such other persons as may be appointed for imparting education instructions. or conducting research in the University and are designated as Teachers by the Ordinances; (s) “Treasurer". “Registrar". “Deputy Registrar“, “Finance Officer", Controller of Examinations"; “Librarian". or “Proctor" means respectively the ' Treasurer, the Registrar. the Deputy Registrar. the Finance Ofliccr. the Controller of Examinations. the Librarian or the Proctor of the University; 14:. KPH Dma t Viomt:

. . .

At? Ilta &MINT fluid, 24 2015 17

"Trust" means Shri Jagdish Jan Kalyan Educational Trust.

Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Trust

Act,1882.

"University" means the J.S University Shikohabad, Firozabad, Uttar

Pradesh eastablished•under section 3.

(1) There shall be established at Shikohabad in district Firozabad of Uttar

Pradesh by the Trust, Shri Jagdish Jan Kalyan Educational Trust, Shikohaliad, Firozabad

a *not for profit' Trust registered under the Indian Trust Act,1882 a University in the

name ofJ.S University Shikohabad, Firozabad, Uttar Pradesh.

(2) The University shall be a body corporate.

The sponsoring body, the Trust shall, for the purposes of establishing the

University under this Act, fulfill the following conditions, namely:-

create a Permanent Endowment fund with minimum of Rs. 10 (ten)

crore;

duly possess minimum 40 acres contiguous land earmarked for the

University;

construct on land referred to in clauses (b) buildings of at least 24000

sq. meter carpet area, out of which at least 50 per cent shall be utilized for

academic and administrative purposes;

install equipments, computers, fumitures, assets, infrastructural

facilities [other then building 'mentioned in (b) above] and other consumables

and non consumables of 'minimum Rs. I (one) crore in offices and laboratories

in the building referred to in clause (b). and an undertaking of procuring the

computers, fumitures, assets, infrastructural facilities [other than building

mentioned in (b) above] and other consumables and non consumables of

minimum four crore rupees in the next 5 years;

appoint at least one Professor. two Associate Professors and

sufficient number of Assistant Professors and supporting staff members in every

department or discipline.

purchase of books and periodicals worth Rs. 10 lalch in the library and

also undertake to invest Rs. 50 lakh for the books , periodicals , computer

library networking and other library facilities in the first three years;

undertake to arrange the co-curricular activities, ' extracurricular

activities, debate, competitions, quiz programmes. sports, NSS and NCC for the

student's as Per the standards of regulatory bodies;

standards and conditions set by UGC, AICTE, NCTE, BCI and other

regulatory bodies established by the State or Central Governments are to be

satisfied;

undertake to establish the provident fund for the employees of the

' University and to introduce other welfare schemes;

(j) make the Statutes and the Ordinances for the administration and

functioning of the University;

(k) any arrangements made by the University shall not differ from the

provisions of the Act and regulations of the University Grants Commission and

other regulatory bodies.

Establishment of the University

Conditions for the establishment of the University

image16.tif

5%: an? new Warm. 24 112015 l7 M (t) “Tmst” means Shri Jagdish Jan Kalyan Educational Trust. Shikohabad, F irozabad a ‘not for profit‘ Trust registered under the Indian Trust Act,1882. (u) “University“ means the 1.5 University Shikohabad, Firezabad, Uttar Pradesh eastablished-under section 3. l 3. (1) There shall be established at Shikohabad in district Firozabad of Uttar Pradesh by the Trust. Shri Jagdish Jan Kalyan Educational Trust, Shikohabad, Firozabad a ‘not for profit’ Trust registered under the Indian Trust Act,1882 a University in the name of J .S University Shikohabad, Firozabad. Uttar Pradesh. (2) The University shall be a body corporate. 4. The sponsoring body, the Trust shall. for the purposes of establishing the University under this Act, fulfill the following conditions, namely:- (a) create 2 Permanent Endowment fund with minimtim of Rs. l0 (ten) crore; (b) duly possess minimum 40 acres contiguous land earmarked for the University: ((2) construct on land referred to in clauses (b) buildings of at least 24000 sq. meter carpet area. out of which at least 50 per cent shall beIutilized for academic and administrative purposes; ' (d) install equipments, computers, furnitures, assets, infrastructural facilities [other then building‘mentioned in (b) above] and other consumables and non consumables of 'minimum Rs. 1 (one) crore in offices and laboratories in the building referred to in clause (b). and an undertaking of procuring the computers, firmitures,‘ assets, infrastructural facilities [other than building mentioned in (b) above] and other consumables and non consumables of minimum four crore rupees in the next 5 years; (e) appoint at least one Professor. two Associate Professors and sufficient number of Assistant Professors and supporting staff members in every department or discipline. (0 purchase of books and periodicals worth Rs. 10 lakh in the library and also undertake to invest Rs. 50 lakh for the books , periodicals , computer . library networking and other library facilities in the first three years; ' (g) undertake to arrange the co-curricular activities, extracurricular activities. debate. competitions. quiz programmes. sports. N55 and NCC for the students as per the Standards of regulatory bodies: (h) standards and conditions set by UGC. AlCTE, NCTE. BC] and other regulatory bodies established by the State or Central Governments are to be .. satisfied; ' I ' (i) undertake to establish the provident fund for the employees of the ' University and to introduce other welfare schemes; (i) make the Statutes and the Ordinances for the administration and ifiinctioning of the University; _ V ' (k) any arrangements made by the University shall not differ from the ’ provisions of the Act and regulations of the University Grants Commission and other regulatory bodies. Establishment of the University Conditions for the establishment ofthc University

tesa....srat71 ‘tc-P leaf 3TTEMMT1 41%4d. 24 2015 18

(I) to ensure transparent functioning of the University shall put the

clearances obtained from the Regulatory Bodies in the public domain:

Starting of the University

Objects of the University

Powers of the University

to provide for instruction in such branches of learning as the

University may, from time to time, determine and to make provisions for

research and for the advancement and dissemination of knowledge and skills;

to impart and promote the study of Science, Engineering and

Technology, Architecture, Biomedical Sciences, Medical Sciences, Dental

Sciences, other various Sciences not specifically mentioned. Nursing,

Rehabilitation, Ayurveda, Unani, Homeopathy, Naturopathy, Siddha,

Veterinary Sciences, Agriculture. Pharmacy, Management, Hotel and

Hospitality Management, Law and other Professional courses and also History,

Religions, Culture, Commerce, Economics, Humanities, Philosophy,

Languages, Education, Journalism, Social Sciences, Music, Art, Physical

Education etc. or any 'other subject as decided by Academic Council from time

to time through in-campus, off-campus, offshore-campus and satellite centres or

by conducting centres or by distant educational programmes etc. as decided by

the academic council of the University from time to time;

to honour educational stalwarts and persons of academic eminence

with decoration of professor Emeritus:

246 RPM Data I Ve:1-2015

furnish information to the State Government in the prescribed

format as per periodicity determined by the State Government;

such other conditions as may be required by the State Government to

be fulfilled before the establishment of the University.

5. (1) The University shall start operation only after the State Government

issues to the Trust a letter of authorization for the commencement of the functioning of

the University.

(2) The State Government shall issue the letter of authorization after receipt of

an unambiguous affidavit along with documents from the Trust to the effect that all

conditions referred to in section 4 have been fulfilled.

6. The objects of the University shall be to disseminate and advancement of

knowledge and skill for providing instructional, research and extension of facilities in

such branches of learning as it may deem fit and the University shall endeavour to

provide to students and teachers the necessary atmosphere and facilities for the

promotion of:-

innovations in education leading to restructuring of courses, new

methods of teaching. training and learning including online learning, blended

learning, continuing education and such other modes and. integrated and

wholesome development of personality;

studies in various disciplines;

interdisciplinary studies;

national integration, secularism, social equity and inculcation of

international understanding and ethics.

7. The University shall have the following powers, which it will exercise as

per guidelines and norms as prescribed by UGC and State Government from time to time

namely:-

image17.tif

an? m WWW. 24 Ti, 2015 (l) to ensure transparent functioning of the University shall put the clearances obtained from the Regulatory Bodies. in the public domain: (m) fumish information to the State Government in the prescribed format as per periodicity determined by the State Government; (n) such other conditions as may be required by the State Government to be fulfilled before the establishment of the University. gaming nfthc 5, (1) The University shall stan operation only after the State Government UniVmi‘Y issues to the Trust a letter of authorization for the commencement of the functioning of the University. (2) The State Government shall issue the letter of authorization after receipt of an unambiguous affidavit along with documents from the Trust to the effect that all conditions referred to in section 4 have been fulfilled. Obj-Nisan” 6‘ The objects of the University shall be to disseminate and advancement of Univmily knowledge and skill for providing instructional, research and extension of facilities in such branches of learning as it may deem fit and the University shall endeavour to provide to students and teachers the necessary atmosphere and facilities for the promotion of:- (a) innovations in education leading to restructuring of courses, new methods of teaching. training and learning including online learning, blended learning. continuing education and such other modes and‘ integrated and wholesome development of personality; (b) studies in various disciplines; (c) interdisciplinary studies; (d) national. integration, secularism, social equity and inculcation of international understanding and ethics. Powers arm: 7‘ The University shall have the following powers, which it will exercise as unim‘i‘y per guidelines and norms as prescribed by UGC and State Government from time to time namely:- (a) to provide for instruction in such branches of learning as the University may, from time to time, determine and to make provisions for research and for the advancement and dissemination of knowledge and skills; (b) to impart and promote the study of Science, Engineering and Technology, Architecture, Biomedical Sciences, Medical Sciences, Dental Sciences, other various Sciences not specifically mentioned. Nursing, Rehabilitation, Ayurveda, Unani, Homeopathy, Naturopathy, Siddha, Veterinary Sciences. Agriculture. Pharmacy, Management, Hotel and I Hospitality Management. Law and other Professional courses and also History, Religions. Culture, Commerce, Economics, Humanities, Philosophy, Languages, Education, Journalism, Social Sciences, Music, Art, Physical Education etc. or any iother subject as decided by Academic Council from time to time through in-campus, off-campus, offshore-campus and satellite centres or by conducting centres or by distant educational programmes etc, as decided by the academic council of the University from time to time; (c) to honour educational stalwarts and persons of academic eminence with decoration of professor Emeritus: 246 RPM Data 1 Vid-IOIS

\i-cH waTT 3RITEITT4 9.4d, 24 tiff, 2015 - 19

to grant, subject to such conditions as the University may determine,

diplomas or certificates to, and confer degrees or Other academic distinctions on

the basis of examinations, evaluation or any other method of testing of persons,

and to withdraw any Auch diplomas. certificates, degrees or other academic distinctions fbr good and sufficient cause;

to confer honorary degrees or other distinctions in such manner as may be prescribed;

(I) to provide education and training including correspondence as such

other courses, to such persons as are not members of the University, as it may determine;

to institute as per UGC norms and State Government regulations

Directorships, Principal-ships, Professorships, Associate Professorships,

Assistant Professorships, and other teaching or academic posts required by the

University and to make appointments for the same;

to create administrative, ministerial and other posts and to make appointments thereto;

to appoint/engage persons of eminence, working in any other

University or organization permanently or for a specified period;

to eh-operate, raAlaborate or associate with any other University or

Authority or Institution in India and abroad in such manner and for such

purpose as the University may determine;

to establish and maintain schools, centres, specialized laboratories in

other units for research and instructions as are in the opinion of the University,

necessary for the furtherance of its objects;

(1) to institute and award fellowship' s, scholarships, studentships, medals and prizes;

to establish and maintain and supervise residences, hostels within the

University and promote the health and general- welfare activities for students and staff;

to make provisions for research and consultancy, and for that purpose

to enter into such arrangements with other institutions or bodies as the • University may deem necessary; c.

(o) to declare a centre, an institution, a department, or school, as the case ,• may be, in accordance with the Statutes;

(p) to determine standards in accordance with UGC norms/State norms

for admission into the University, which may include examination, evaluation

• or any other method of testing to ensure quality;

to demand and receive payment of fees and other charges;

to make special arrangements in respect of women and other

disadvantaged students as the University may consider desirable;

• . (s) to regulate and enforce discipline among the employees and students

of the University and take such disciplinary measures in this regards as may be

deemed necessary by the University;

to make arrangements for•promoting the health and general welfare of the employees of the University;

to receive donations and to acquire, hold, manage and dispose of any property, movable or immovable for the welfare of the University;

image18.tif

mmmm, 24 G131, 2015 "19 (d) to grant, subject to such conditions as the University may determine, diplomas or certificates to, and confer degrees or other academic distinctions on the basis of examinations, evaluation or any other method of testing of persons, and to withdraw any such diplomas. certificates, degrees or other academic distinctions for good and sufficient cause; (e) to confer honorary degrees or other distinctions in such manner as may be prescribed; (t) to provide education and training including correspondence as such other courses, to such persons as are not members of the University, as it may determine; (g) to 'institute as per UGC norms and State Govemment regulations Directorships, Principal-ships, Professorships, Associate Professorships, Assistant Professorships. and other teaching or academic posts required by the University and to make appointments for the same; Q, (h) to create administrative, ministerial and other posts and to make appointments thereto; (i) to appoint/engage persons of eminence, working in any other University or organization permanently or for a specified period; (1') to co-operate, dollaborate or associate with any other University or Authority or Institution in India and abroad in such manner and for such purpose as the University may determine; . (k) to establish and maintain schools, centres, specialized laboratories in other units for research and instructions as are in the opinion of the University, necessary for. the furtherance ofits objects: (I) to institute and award fellowships, scholarships, studentships, medals and prizes; (m) to ”establish and maintain and supervise residences, hostels within the University and promote the health and general- welfare activities for students and staff; " j (n) to make provisions for research and consultancy, and for that purpose i to enter into such arrangements with other institutions or bodies as the ‘ University may deem necessary; ' °' ‘ (o) to declare a centre, an institution. a department, or school, as the case I , .i “may be, in accordance with the Statutes; (p) to_dctermine standards in accordance with UGC nouns/State norms 'fl’for admission into the University, which may include examination, evaluation . or any other method of testing to ensure quality; (q) to demand and receive payment of fees and other charges; (r) to make special arrangements in respect of women and other ‘ disadvantaged students as the University may consider desirable, " * - . (s) to regulate and enforce discipline among the employees and students ' of the University and take such disciplinary measures in this regards as may be _ deemed necessary by the University; , (t) to make arrangements for'promoting the health and general welfare of the employees of the University; (u) to receive donations and to acquire, hold manage and dispose of any ‘ Propeny, movable or immovable for the welfare of the University;

?la

‘3TI.?iT1 affiltfRvI Tr1/47e, 24 ‘9, 2015

Ill I

01: •...

, .41

;I :011' In Admission and

Standards

I

H

University open to all class's and creeds

Il‘rie 011icers of the tJniversity

?An RPII Ds v :01

(v) to borrow, mortgage with the approval of the Trust on the security of

the property of the University, money for the purposes of the University;

(w)to appoint either on contract or otherwise, visiting professors emeritus

professors. consultants, fellows, scholars, artists, course writers and such other

persons who may contribute to the advancement of the objects of the

University;

to organize and to undertake extramural studies and extension service;

and

to do all such other acts and things as may be necessary, incidental or

conducive to the attainment of all or any of the objects of the University.

8. (1) Admission to the different academic programmes shall be made in

accordance with the laws and University Grants Commission norms for quality for

the time being in force.

The University shall ensure that the academic standards of the courses

offered by the University are in accordance with the guidelines of the University

Grants Commission and other statutory bodies as the case may be.

The teacher student ratio shall be in accordance with the guidelines of

the University Grants Commission and specific Councils.

Academic performance of the University with respect to standards set

1:iy the UGC/State Government/other Regulatory Bodies shall be periodically

reviewed by a Committee of Academic Experts constituted by the Chancellor

consisting of one Chairman and four members including two members as nominees

of the State Government.

The Chairman and other four expert members shall be from academic

field not below the rank of Professor and from one of the spi-cialization being run

in the University. The report of the Committee shall be submitted to the State

Government by the Chancellor and discussed in the Court of the University for

further, necessary actions. A copy of the report along with the actions taken by the

University shall be sent to the UGC and State Government and also displayed in

the public domain.

9. The University shall be open to persons of either sex and of whatever

race, creed, caste or class, and it shall not be lawful for the University to adopt to

impose on any person any test whatsoever of his religious belief profession in

order to entitle him to be admitted therein as an officer, a teacher, staff member,

student, or to hold any office therein or to graduate thereat:

Provided that reservation in the posts and recruitment of the employees

and reservation of seats for admission in any course of study in. the University for

the students belonging to the Scheduled Castes, Scheduled Tribes and Other

Backward Classes of citizens shall be regulated by the order of the State

Government issued from time to time.

10. The following shall be the officers of the University:-

the Chancellor,

the Pro-Chancellor.

the Vice-Chancellor.

image19.tif

20 an? gen W m .24 aft. 2015 {3,112 . . . (v) to borrow, mortgage with the approval of the Trust on the security of l the property of the University, money for the purposes of the University; (w)to appoint either on contract or otherwise. visiting professors emeritus professors. consultants. fellows. scholars, artists, course writers and such other persons who may contribute to the advancement of the objects of the University; (x) to organize and to undertake extramural studies and extension service; and I (y) to do all such other acts and things as may be necessary, incidental or conducive to the attainment ofall or any of the objects of the University. Admission and 8. (l) Admission to the different academic programmes shall be made in sundms accordance with the laws and University Grants Commission norms for quality for the time being in force. (2) The University shall ensure that the academic standards of the courses offered by the University are in accordance with the guidelines of the University Grants Commission and other statutory bodies as the case may be. (3) The teacher student ratio shall be in accordance with the guidelines of the yniversity Grants Commission and specific Councils. (4) Academic performance of the University with respect to standards set by the UGC/State Govemment/other Regulatory Bodies shall be periodically reviewed by a Committee of Academic Experts constituted by the Chancellor consisting of one Chairman and four members including two members as nominees _ of the State Government. (5) The Chairman and other four expert members shall be from academic field not below the rank of Professor and from one of the specialization being run in the University. The report of the Committee shall be submitted to the State Government by the Chancellor and discussed in the Court of the University for further, necessary actions. A copy of the report along with the actions taken by the University shall be sent to the UGC and State Govemment and also displayed in the public domain. ' Univmny 0pm m 9. The University shall be open to persons of either sex and of whatever a" clnsscs and ', race, creed, caste or class, and it shall not be lawful for the University to adopt to creeds i . . , . , . impose on any person any test whatsoever of his religious belief professron in order to entitle him to be admitted therein as an officer, a teacher, staff member, student, or to hold any office therein or to graduate thereat 2 Provided that reservation in the posts and recruitment of the employees and reservation of seats for admission in any course of study in the University for the students belonging to the Scheduled Castes, Scheduled Tribes and Other Backward Classes of citizens shall be regulated by the order of the State Government issued from time to time. Officers oflhe _ 10. The following shall be the officers ofthe University2~ ”mushy (a) the Chancellor, (b) the Pro-Chancellor. (c) the Vice-Chancellor. 2th RPM Data I th-L‘tll,‘

‘3T1 Abr 31W1T-TRuf Th-ife, 24 ok-1, 2015 21

(d) the Pro-Vice-Chancellor,

the Director/Principal,

the Registrar,

the Dean of Faculty,

the Dean of Students' Welfare,

the Controller of Examinations,

(j) the Chief Proctor,

(k) the Treasurer,

(I) the Finance Officer, and

(m) such other officers as may be declared by the Statutes to be officers of the University.

11. (1) The Chancellor shall be appointed by the Management Committee of the Trust for a period of three years.

(2) The Chancellor shall by virtue of his office, be the Head of the University and shall constitute interim Executive Council.

(3) The Chancellor may by writing under his hand addressed to the Trust resign from his office.

12. (1) The Pro:Chancellor shall be appointed by the Management Committee of the Trust for a period of three years. . .

(2) The Pr&Cliaticellor shall assist the Chancellor in discharging his duties and preside at the cenvocation in his absence.

—(3) The Pro-Chancellor may in writing under his hand addressed to the ...Chancellor resign from his office.

13. (1) The Vice-Chancellor shall be appointed by the Chancellor in such

manner as may be prescribed, for a period of three years.

(2)11e Vice-Chancellor shall be the principal executive and academic officer

of the University and shall be the Chairman of the Academic Council and Planning

Board of the University, and shall exercise general, supervision and control over the

affairs of the ,University ?and give effect to the decisions of the authorities of the University. • .

(3) The Vice-Chancellor may, if he is of the opinion that immediate action is

necessary on any matter, exercise any power conferred on any authority of the University by or. under. this Act and shall convey to such 'authority the action taken by him on such matters:

Rrovided that if the authority of the University or any person in the service of

the University who is aggrieved by the action taken by the Vice-Chancellor under this

sub-section may prefer an appeal to the Chancellor within thirty days from the date of

corrununication of such decision. The Chancellor may confirm, modify or reverse such action taken by the Vice-Chancellor.

. (4) The Vice-Chancellor shall exeicise sudh powers and perform such other functions as may be prescribed.

(1) The Pro-Vice-Chancellor shall be appointed by the Vice- Chancellor in

such manner and shall exercise such powers and fierform such functions as may be prescribed.

(2) The Pro-Vice-Chancellor appointed under sub-seetion (1) shall discharge his

duties in addition to his duties as a Professor.

The

Chancellor

The Pro-

Chancellor

The Vice-

Chancellor

The Pro-

Vice-

Chancellor

image20.tif

WW}?! Warm .24 GEL 2015 (d) the Pro-Vicé-Chancellor, (e) the Director/Principal, (f) the Registrar, . (g) the Dean ofFaculty, (h) the Dean of Students' Welfare, (i) the Controller of Examinations. g (j) the Chief Proctor, (k) the Treasurer, (l) the Finance Officer. and * (m) such other officers as may be declared by the Statutes to be ofliecrs _of the University. ll. (1) The Chancellor shall be appointed by the Management Committee of the Trust for a period of three years. (2) The Chancellor shall by virnie of his office, be the Head of the University and shall constitute interim Executive Council. (3) The Chancellor may by writing under his hand addressed to the Trust resign from his off ee 12 (l) The Pro- Chancellor shall be appointed by the Management Committee of the Trust for a period of three years. . . “ .v - (2) The Pro-Chancellor shall assist the Chancellor in discharging his duties and preside at the convocation in his absence. "‘(3) The Pro-Chancellor may in writing under his hand addressed to the ‘ :Chancellor resign from his office. 13. (l) The Vice- Chancellor shall be appointed by the Chancellor in such ‘ manner as may be prescribed, for a penod of three years. (2) The Vice-Chancellor shall be the principal executive and academic officer of the University and shall be the Chairman of the Academic Council and Flaming Board of the University, and shall exercise general, supervision and control over the affairs 'of the'I‘Universitygand give effect to the decisions of the authorities of the University. , ' t (3) The Vice- Chancellor may if he is of the opinion that immediate action is necessary on' any matter, exercise any power conferred on any authority of the . University by or. under this Act and shall convey to such authority the action taken by him on such matters: Provided that if the authority of the University or any person in the service of the University who rs aggrieved by the action taken by the Vice- Chancellor under this sub- -scction may prefer an appeal to the Chancellor within thirty days from the date of Commuhication of such decision. The Chancellor may confirm, modify or reverse such action taken by the Vice-Chancellor. _ (.4) The Vice-Chancellor shall exercise such powers and perform such other functions as may be prescribed. 14. (l) The Pro- Vice- Chancellor shall be appointed by the Vice- Chancellor in SuCh manner and shall exercise such powers and perform such functions as may be Prescribed (2) The Pro- Vice- Chancellor appointed under sub- -sec'tion ( I) shall discharge his duties in addition to his duties as a Professor. 2] . The Chancellor The Pm~ Chancellor The Vice- Chancellor Tln: Pro Vice- Chancellor

amimmessiSmaeroasse.-

7 2 ‘§-c-N 31t'41- 31-iiRrFut TIVZ, 24 3J9, 2015

A) 4

Director/ Pnncipal

The Registrar

Dean of Faculty

'The Treasurer

Finance Officer

Other Officers

Authorities of the University

The Court

The Pro-Vice- Chancellor shall assist the Vice- Chancellor in discharging

day to day duties as and when required by the Vice- Chancellor.

The Pro-Vice- Chancellor shall get honorarium of such amount as may be

determined by the Trust.

15.The Director/Principal shall he appointed, in such manner and shall exercise

such powers and perform such functions as may be prescribed.

16.0) The Registrar shall be appointed in such manner as may be prescribed.

The Registrar shall have the power to enter into agreements, sign documents

and authenticate records on behalf of the University and shall exercise such other powers

and perform such other functions as may be prescribed.

The Registrar shall be the ex-officio Secretary of the Executive Council and

the Academic Council.

17.Every Dean shall be appointed in such manner and shall exercise such

powers and perform such functions as may be prescribed.

I 8.The Treasurer shall be appointed in such manner and shall exercise such

powers and perform such functions as may be prescribed.

19.0) The Finance Officer shall be appointed in such manner and shall exercise,'

such powers and perform such function § as may be prescribed.

(2) The Finance Officer shall be the ex-officio Secretary of Finance Committee: ,

20.The manner of appointment and powers and duties of the other officers of

the University including the Dean of Students Welfare, Controller of Examinations and

Chief Proctor shall be such as may be prescribed.

21. The following shall be Authorities of the University:-

the Court,

the Executive Council

the Academic Council,

the Finance Committee

the Planning Board.

the Board of Faculties,

the Admissions Committee:

the Examinations Committee and,

such other authorities as may be declared by the Statutes to be

authorities of the University. 22.( I) The Constitution of the Court and the term of office of its members shall

be such as may be prescribed.' (2) Subject to provisions of this Act the Court shall have the following powers

and functions, namely:- to review from time to time, the -broad policies and programmes of

the University and suggest measures for the working, improvement and

development of the University:

to consider and pass resolutions on the Annual Report and Annual

accounts of the University and Audit Report of such accounts;

to advise the Chancellor in respect of any matter which may be

referred to it for advice;

to perform such other functions as may be prescribed.

244 RN I Data I Vi42015

image21.tif

am new W 1m, 24 fifi. 2015 ;_—————_———_———’_-———— (3) The Pro—Vice- Chancellor shall assist the Vice- Chancellor in discharging day to day duties as and when required by the Vice- Chancellor. (4) The Pro-Vice- Chancellor shall get honorarium of such amount as may be determined by the Trust. Dimmer; 15.The Director/Principal shall be appointed, in such manner and shall exercise Pl""CiF'a' such powers and perform such functions as may be prescribed. 11.c chislm, 16.(l) The Registrar shall be appointed in such manner as may be prescribed. (2) The Registrar shall have ihe power to enter into agreements, sign documents and authenticate records on behalf of the University and shall exercise such other powers and perform such other functions as may be prescribed. (3) The Registrar shall be the ax—oflcio Secretary of the Executive Council and the Academic Council. m as» ass-«v.15: Dcanof l7.F.very Dean shall be appointed in such manner and shall exercise such Faculty powers and perform such functions as may be prescribed. . . l8.'l'he Treasurer shall be appointed in such manner and shall exercise such I‘helrmsurer powers and perform such functions as may be prescribed. Finance Officer such powers and perform such functions as may be prescribed. (2) The Finance Officer shall be the ex-oflcio Secretary of Finance Committee: .' 20.The manner of appointment and powers and duties of the other officers of l9.(l) The Finance Officer shall be appointed in such manner and shall exercisef u—‘ahn‘w new .. ... _ Other Oflicers the University including the Dean of Students' Welfare, Controller of Examinations and ChicfProctor shall be such as may be prescribed. Authorities of 21. The following shall be Authorities of the University:- the University , (a) the Court, (b) the Executive Council , (c) the Academic Council. (d) the Finance Committee , (e) the Flaming Board. (0 the Board of Faculties. (g) the Admissions Committee - (h) the Examinations Committee and , (i) such other authorities as may be declared by the Statutes to be authorities of the University. The Conn 22.( l) The Constitution of the Court and the term of office of its members shall be such as may be prescribed.’ (2) Subject to provisions of this Act the Court shall have the following powers and functions, namely:- ‘ (a) to review from time to time, the‘broad polidies and programmes of the University and suggest measures for the working, improvement and development ot‘the University: (b) to consider and pass resolutions on the Annual Report and Annual accounts of the University and Audit Repon of such accounts. . (c) to advise the Chancellor in respect of any matter which may be referred to it for advice; (d) to perform such other functions as may be prescribed. 240 RP” Date I Vid‘ZOIS

0 1 ‘3c1' 31t4T 31911B7U1 II WC, 24 Wff, 2015

*Val

23. (I) The Executive Council shall be the principal executive body of the The Eiecutive

University. Council. .

The Constitution of the Executive Council, the term of the office of its

menibers and its powers and duties shall be such, as may be prescribed.

Joint Secretary to the Government of Uttar Pradesh shall be the member of

the Executive Council.

24..(1) The Academic Council shall be the principal academic body of the.

University and shall subject to the provisions of the Statutes and the Ordinances, co-

ordinate and exercise general supervision over the academic policies of the University.

(2) The constitution of the Academic Council, the term of office of its members

and its powers and functions shall be 'such, as may be prescribed.

(I) The Finance Committee shall be the principal financial body of the

University to take dare of the financial matters.

(2) The constitution powers and functions of the Finance Committee shall be

such, as may be prescribed.

(1) The Planning Board shall be the principal planning body of the

University. The Board shall ensure that the infrastructure and academic support system

meets the norms of the University Grants Commission or the respective Councils.

(2) The constitution, of the Planning Board, term of office of its members and

its power and functions shall be such as may be prescribed.

The constitution, powers and functions of the Board of Faculties, the

Admissions Committee, the Examination Committee and of such other authorities of the

University which may be declared by the Statutes to be authorities of the University shall

be such as may be prescribed.

28. (1) The. Executive Council shall make the statutes of carrying out the

purposes of this Act.

(2) Subject to the provisions of this Act the Statutes may provide for all or any

of the following matters, namely:-

the constitution, powers and functions of the authorities of the

University, as may be constituted from time to time;

the appointment and continuance in office of the members of the said

authorities, filling of vacancies of members of the said authorities, filling of

vacancies of members and all .other matters relating to those authorities for

which it may be necessary to provide;

the appointment, powers and duties of the officers of the University

and their emoluments;

the appointment of teachers of the University and other academic and

'administrative staff and their emoluments;

the appointment of teachers and other academic and administrative

staff working in the University or Institution for specific period for undertaking

a 'joint project;

the conditions of Service of employees including provisions for

retirement benefits, insurance and provident fund, the manner of termination of

service and disciplinary actions;

The Academic Council

The Finance Committee

The Planning Board

Board of Faculty, Admission Committee, Examination Committee and other Authorities of the University

Power to make statutes

fr

image22.tif

‘ an? steer. ,amtww m. 24 aft, 2015 i 23. (l) The Executive Council shall be the principal executive body 'of the University. (2) The Constitution of the Executive council, 'the term of the office of its members and its powers and duties shall be such, as may be prescribed. (3) Joint Secretary to the Government of Uttar Pradesh shall be the member of the Executive Council. 24..(1) The Academic Council shall be the principal academic body of the. University and shall subject to the provisions of the Statutes and the Ordinances, co- ordinate and exercise general supervision over the academic policies of the University. (2) The constitution of the Academic Council, the term of office of its members and its powers and functions shall be 'such, as may be prescribed. 25. (l) The Finance Committee shall be the principal financial body of the University to take care of the financial matters. (2) The constitution powers and functions of the Finance Committee shall be such. as may be prescribed. 26, (l) The Flaming Board shall be the principal planning body of the University. The Board shall ensure that the infrastructure and academic support system meets the norms of the University Grants Commission or the respective Councils. . (2) The constitution, of the Planning Board. term of office of its members and its power and functions shall be such as may be prescribed. 27. The constitution. powers and functions of the Board of Faculties, the Admissions Committee, the Examination Committee and of such other authorities of the University which may be declared by the Statutes to be authorities of the University shall be such as may be prescribed. 28. (l) The Executive Council shall make the statutes of carrying out the purposes of this Act. (2) Subject to the provisions of this Act the Statutes may provide for all or any ofthc following matters, namely:- 7 (a) the constitution. powers and functions of the authorities of the ’I University, as may be constituted from time to time; . (b) the appointment and continuance in office of the members of the said authorities, filling of vacancies of members of the said authorities, filling of : vacancies of members and all other matters relating to those authorities for which it may be necessary to provide; 1 (c) the appointment, powers and duties of the officers of the University and their emoluments; (d) the appointment of teachers of the University and other academic and 'administrative staff and their emoluments; (e) the appointment of teachers and other academic and administrative staff working in the University or Institution for specific period for undertaking ‘ajoint project; (0 the conditions of service of employees including provisions for ' retirement benefits insurance and provident fund the manner of termination of service and disciplinary actions; ”23,‘ .4 The Executive Council ' . The Academic Council The Finance Committee The Planning Board Board of Faculty. Admission Committee, Examination Committee and other Authorities of the University Power to make statutes

•••,% ,1 .,

A .4

rtf i;

1.•

1, ra II :ft! [••••re'l It

‘ir

Ilr

.1.:

24 dri•( TraTI 31711tIT71 1IulC. 24 ‘9, 2015

the principles governing seniority of service of employees;

the procedure for settlement of disputes between employees or

students and the University; the procedure for appeal to the Executive Council by any employee

or students against the action of any officer or other authority of the University;

the conferment of honorary degrees;

the withdrawal of degree, diploma, certificate and other academic

distinctions; (I) the institution of fellowships, scholarships, studentships, medals and

prizes; the maintenance of discipline among the students;

the establishment and abolition of Department, Centers and othei

constituent institutions / colleges etc;

the delegation of powers vested in the authorities or officers of the

University; and all other matters, which are in this Act or may be prescribed.

The Executive Council shall not make, amend or repeal any Statute affecting

the powers or constitution of any authority of the University until such authority has been

given an opportunity of expressing an opinion in writing on the proposed changes and

any opinion so expressed shall be considered by the Executivt. Council.

Notwithstanding anything contained in the foregoing sub-sections the

Chat :I tor may direct the University to make provisions in the Statutes, in respect of any

matter specified by him and if the Executive Council is unable to implement such a

direction within sixty drfys of its receipt, the Chancellor may, after considering the

reasons, if any, communicated by the Executive Council for its inability to comply with

such direction, make or amend the Statutes accordingly as he may deem fit.

29. Subject to the provisions of this Act and the Statutes, the Ordinances shall Power to make • Ordinances

be made by the Executive Council which may provide for all or any of the following

matters, namely:- the admission of students to the University and their enrolment as

the courses of study to be laid down for all degrees, diplomas and

certificates of the University; the medium of instruction and examination;

the award of degree, diploma, certificate and other academic .

distinction, the qualification for the same and the means to be taken relating to

the granting and obtaining of the same; the fees to be charged for courses of study in the University and for

admission to the examinations, degrees, diplomas and certificates of the

University; the conditions for the award of fellowships, scholarships,

studentships, medals and prizes; the conduct of examinations, including the term of office and manner

of appointment and the duties of examining bodies, examiners and moderators;

the conditions of residence of the students of the University;

the special arrangements, if any, which may be made for the

residence, discipline and teaching of women students and prescribing of special

courses of studies for them within the University;

2.16 IIPH Da I Vid-2015

MI ILL -

such;

image23.tif

l i 24 ' WWWWJAVfimis - his”; “ I (g) the principles governing seniority of service of employees; (h) the procedure for settlement of disputes between employees or students and the University; (i) the procedure for appeal to the Executive Council by any employee or students against the action of any officer or other authority of the University; (j) the conferment of honorary degrees; (k) the withdrawal of degree, diploma, certificate and other academic distinctions; (l) the institution of fellowships, scholarships, studentships, medals and prizes; (rn) the maintenance of discipline among the students; (n) the establishment and abolition of Department, Centers and other constituent institutions / colleges etc; (o) the delegation of powers vested in the authorities or officers of the sa— -ziarzza W.» University; and (p) all other matters. which are in this Act or may be prescribed. (3) The Executive Council shall not make, amend or repeal any Statute affecting the powers or constitution of any authority of the University until such authority has been given an opportunity of expressing an opinion in writing on the proposed changes and any opinion so expressed shall be considered by the Executiv Council. (4) Notwithstanding anything contained in the foregoing sub-sections the Cha- ellor may direct the University to make provisions in the Statutes, in respect of any ‘ matter specified by him and'if the Executive Council is unable to implement such a direction within sixty days of its receipt, the Chancellor may, after considering the reasons, if any, communicated by the Executive Council for its inability to comply with such direction, make or amend the Statutes accordingly as he may deem fit. 29‘ Subject to the provisions of this Act and the Statutes, the Ordinances shall Power to make ' ‘ be made by the Executive Council which may provide for all or any of the following Ordinances matters, namely:- (a) the admission of students to the University and their enrolment as such; (b) the courses of study to be laid down {or all degrees, diplomas and certificates of the University; _ ' I. (c) the medium of instruction and examination; (d) the award of degree, diploma, certificate and other academic . distinction, the qualification for the same and the means to be taken relating to the granting and obtaining of die same; , (e) the fees to be charged for courses of study in the University and for admission to the examinations, degrees, diplomas and certificates of the University; . (f) the conditions for the award of fellowships, scholarships. studentships. medals and prizes; (g) the conduct ofexaminations, including the term of office and manner of appointment and the duties of examining bodies. examiners and moderators; (h) the conditions of residence of the students of the University; (_ i) the special arrangements, if any. which may be made for the residence, discipline and teaching of women students and prescribing of special courses of studies for them within the University; 246 H?“ D.“ l \'id 2015

‘tcti ptra 371191Vu1 , 24 i, 2015

• the appointment and emoluments of employees other than

those for whom provision has been made in the Statutes;

the establishment of Centre of Studies, Board of Studies,

Interdisciplinary Studies. Special Centers, Specialized Laboratories and

other Comniittees;

(I) the manner of co-operation and collaboration with other

Universities and authorities including professional bodies or

associations; .

the creation, composition and functions of any other body

which is considered necessary for improving the academic stature of

the University;

the remuneration to be paid to the examiners, moderators,

invigilators and tabulators; and

(o) such other terms and conditions of service of teachers and

Other academic staff as are not prescribed by the Statutes.

30. (1) The Annual Report to the University shall be prepared under the Annual Report direction of the Executive Council and shall be submitted to the Court on or after such

date as may be prescribed and the Court shall consider the report in its annual meeting;

. (2) The Court shall submit the Annual Report to the Chancellor along with its

,comments, if any.

.31. (ft The Annual Accounts and Balance Sheet of the University shall be Annual

prepared under the directions of the Executive Council and shall, once at least every year Accounts

and at intervals of not more than fifteen months, be audited by an experienced and

qualified firm of Chartered Accountants of repute.

(2) A copy of the Annual Accounts, together with the audit report thereon, shall

be submitted to the Court and the Chancellor along with the observations of the

Executive Council. • . . • (3) Any obkrvations -made by the Chancellor on the annual accounts shall be

bfought to the notice of the -Court and the Executive (Council and the observations, if

any, shall after review by the Executive Council, be submitted to the Chancellor and

shall be put in the public domain. .

32. (1) Every empitiyee of the University shall be appointed/engaged as per Conditions of -Provisions of the Statutes. service of

employees

7 (2) Any dispta arising between the University and any of the employees

appointed substantively, shall be referred to the .Vice Chancellor who shall decide the

dispute after affording an opportunity, to the employee within three months from the date

of its reference.

(3) The aggrieved employee may file an appeal against the order of the Vice-

Chancellor to the Chancellor.

(4) Any dispute in respect of any employee engaged temporarily or on ad-hoc or

Pan time or casual basis snail be heard and decided by the Vice-Chancellor.

(5) Any person aggrieved by the order of the Vice-Chancellor may prefer an .

appeal to the Chancellor. The decision of the Chancellor in such an appeal shall be final ,

and no suit shall lie in any court in respect. of the matters decided by the Chancellor.

33. (1) Any student or candidate for an examination, whose name has been Right to • c.

removed from the lolls of the University by the orders or resolution of the Academic Appeal

image24.tif

wafiasmwwm, 24 an, 2015_ {I . ' (j) the' appointment and emoluments of employees other than those for whom provision has been made in the Statutes; _ (k) the establishment of Centre of Studies Board of Studies, Interdisciplinary Studies Special Centers Specialized Laboratories and other Committees; (1) the manner of co-operation and collaboration with other Universities and authorities including professional bodies or ‘-. V .. . associations;. . t (m) the creation, composition and functions m" any other body which is considered necessary for improving the academic stature of the University; I . , ' (n)' the remuneration to be paid toithe examiners, moderators, t invigilators and tabulators; and I ; ‘ . (0) such other terms and conditions of service of teachers and other academic staff as are not prescribed by the Statutes -30. (l) The Annual Report to the University shall be prepared under the direction of the Executive Council and shall be submitted to the Court on or nfler such date as may be prescribed and the Court shall consider the report in its annual meeting; (2) The Court shall submit the Annual Repon to the Chancellor along with its ,corttment; if any i , (l) The Annual Accounts and Balance Sheet of the University shall be , prepared3 under the directions of the' Executive Council and shall. once at least every year and at intervals of not more than fificen months. be audited by an experienced and qualified firm of Chartered Accountants of repute ' (2) A copy of the Annual Accounts, together with the audit report thereon, shall be submitted to the Court and the Chancellor along with the observations of the ‘ Executive Council. ’ I (3) Any obié‘gwations-made by the Chancellor on the annual accounts shall be - brought to the notice of theCo‘un and the ExecutiveiCouncil and the observations, if any, shall after review by the Executive Council, besubmitted to 'the Chancellor and shall be put in the public domain. . l f 32. (1) Every employee of the University shall be appointed/engaged as per provisions of the Statutes. ‘r (2) Any dispute‘ arising between” the University and any of the employees ’ appointed substantively, shall be referred to the_Vice Chancellor who shall decide the j ‘r ‘ l - dispute after affording an opportunity, to the employee within three months from the date of its reference. , . (3) The aggrieved employee may file an appeal against the order of the Vice- Chancellor to the Chancellor. L.” (4) Any dispute in respect ofany employee engaged temporarily or on ad~ltoc or pan time or casual basis shall be heard and decided by the Vice-Chancellor I (5) Any person aggrieved by the order of the Vice—Chancellor may prefer an . appeal to the Chancellor The decision of the Chancellor tn such an appeal shall be final and no suit shall lie in any court in respect of the matters decided by the Chancellor. 33‘ (1) Any student or candidate for an examination. whose name has been rBmo‘ved from the rolls of the University by the orders or resolution of the Academic 25- Annual Repon ' Annual Accounts Conditions of . service of employer: Right to ' Appeal

26 \i-cH tI 3Fil1t.R77 11-‘71Z, 24 WI, 2015

Employees

Provident Fund

and Pensions

Disputes as to

the constitution

of Authonties

and bodies

Constitution of

Committees

Filling of the

vacancies

Invalidity of

proceeding

Mode of proof

of University

records

Publication of

Statutes and

Ordinance

Permanent

Endowment

Fund

General Fund

246 KPH Data I Vid.7.111!

Council, Proctorial Board or Controller of Examinations as the case may be and who has

been debarred from appearing at the examinations of the University for more than one

year, may within ten days of the date of receipt of such orders or copy of such resolution

appeal in writing to reverse the decision to the aforesaid authorities or the concerned

Committee, as the case may be. (2) Any decision taken by the Vice-Chancellor shall be final.

The University may constitute for the benefit of its employees such pension or

welfare schemes or Provident Fund or provide such insurance schemes as it may deem fit in

such manner and subject to.such conditions as may be decided by the Executive Council.

If. any. question arises as to whether any person has been duly nominated or

appointed as or is entitled to be a member of any authority or other body of the University, the

matter shall be referred to the Chancellor whose decision thereupon shall be final.

Where any authority of the University is liven power under this Act or the

Statutes to appoint Committees, such Committees shall save as otherwise Provided, consist of

the members of the authority concemeland of such other persons as the authority in each

case may think fit. All vacancies among the members (other than ex-officio) of any authority or

other body of the University shall be filled as soon as may be convenient by the person or

body who appointed, nominated or co-opted the members whose place has become vacant for

the remaining term for which he has been apPointed or co-opted.

38.No act or proceedings of any authority of the University shall be invalid merely

by reason of the existence of a vacancy or vatancies among its members.

A copy of any receipt. application, notice, proceeding, resolution of any

authority or Committee of the University or other documents in possession of the University,

if certified by the Registrar, shall be received as prima-facie evidence of the such receipt,

applications. notice. order, proceeding or resolution, documents or the existence of entry in

the register and shall be admitted as evidence of the matters and transactions therein where

the original would. if produced have been admissible in evidence.

(1) Every Statute or Ordinance made under this Act shall be made available in

writing. (2) Each new Statute or Ordinance made under this Act shall be enforced as soon as

it is made by the competent authority. 41. (1) The Trust shall establish a permanent Endowment Fund of at least rupees ten

crore as per law and no money shall be withdrawn from the principal amount of this fund

without prior permission of the State Government.

The University shall have the power to invest the permanent 'Endowment Fund

in such manner as may be prescribed. The University may transfer any amount from the general fund or the

development fund to the permanent endowment fund. Any amount exceeding the minimum amount specified in sub-section 111 may

be withdrawn from the permanent endowment fund by the University for the purposes of

development of the University. 42(1) The University shall establish a general find to which the following amount

shall be credited. namely. -

all J..c. which may be charged by the University:

all sums received from any other sources:

ci all contributions trade by the Trust: and

image25.tif

WWW‘W .24aft.2015 I, t 26 .. Employees Provident Fund and Pensions DispukS as to the constitution of Authontres and bodies Constitution of Committees Filling of the vacancies invalidity of proceeding Mode of proof of University records Publication of Statutes and Ordinance Pemiancnt Endowment Fund General Fund 11(- Kl'li Data \ \‘idalUl.’ Council, Proctorial Board or Controller of Examinations as the case may be and who has been debarred from appearing at the examinations of the University for more than one year, may within ten days of the date of receipt of such orders or copy of melt resolution appeal in writing to reverse the decision to the aforesaid authorities or the concemcd Committee. as the case may be. (2) Any decision taken by the Vice»Chancellor shall be final. 34, The University may constitute for the benefit of its employees such pension or welfare schemes or Provident Fund or provide such insurance schemes as it may deem {it in such manner and subject to‘such conditions as may be decided by the Executive Council. 35. If. any' question arises as'to whether any person has been duly nominated or appointed as or is entitled to be a member of any authority or other body of the University, the matter shall be referred to the Chancellor whose decision thereupon shall be final. 36.Where any authority of the University is given power under this Act or the Statutes to appoint Committees, such Committees shall save as otherwise provided. consist of the members of the authority concemed'and of such other persons as the authority in each one may think fit. 37.All vacancies among the members (other than ex-ajiicia) of any authority or other body of the University shall be filled as soon as may be convenient by the person or body who appointed, nominated or coepted the members whose place has become vacant for the remaining term for which he has been appointed or co—opted. 38.No act or proceedings of any authority of the University shall be invalid merely by reason of the existence of a vacancy or vaCancies among its members. 39. A copy of any receipt. application, notice, proceeding, resolution of any authority or Committee of the University or other documents in possession of the University, if certified by the Registrar: shall be received as prima—facie evidence of the such receipt. applications. notice. order. proceeding or resolution, documents or the existence of entry in the register and shall be admitted as evidence of the matters and transactions therein where the original would. ifproduced have been admissible in evidence. 40. (1) Every Statute or Ordinance made under this Act shall be made available in writing. (2) Each new Statute or Ordinance made under this Act shall be enforced as soon as .it is made by the competent authority. 41 . (1) The Trust shall establish a pennanent Endowment Fund of at least nipees ten crore as per law and no money shall be withdrawn front the principal amount of this fund without prior permission of the State Govemment (2) The University shall have the power to invest the pennancnt Endowment Fund in such manner as may be prescribed. (3) The University may transfer any amount from the general fund or the development fund to the permanent endowment fund (4) Any amount exceeding the minimum amount specified in sub-section (ll may be withdrawn born the pemianent endomncnt fund by the University for the purposes of development of the University. 42.0) The University shall establish a general fund to which the following amount shall be credited. namely (a) all t which may be “hurt-ted by the University: (bl allsui :rcceivcdfmm anyuthcrsources: (c) all contributions made by the Trust: and

‘311N 747( 31774R1:11 410Id. 24 , 2015

(d) all contributions made in this behalf by any other person or bodies which are

I not prohibited by any law for the time being in force.

(2) The money credited to the general fund shall be applied to meet all the recurring

1 expenditures of the University.

43. (1) .The University shall also establish a developthent fund to which the

. following moneys shall be credited, namely :—

(a) development fees, which may be charged from students;

. . (b) all sums received from other sources for the purpose of the development

of the University;

all contributions made by the Trust: •

all contributions made in this behalf by any other person or bodies which

are not prohibited by any law for the time being in force; and

all incomes received from the pennanent endowment fund.

(2) The moneys credited to the development fund from time to time shall be utilized

for the development of the University.

44. The funds established under sections 41, 42 and 43 shall Subject to general

supervision and control of the Court be regulated and maintained in such manner as may be

prescribed.

. 45. The University shall not be eligible for, any grants in aid or any financial

assistance from the State Government or any other body or Corporation owned and controlled

by the State Government. f ,73

The fees charged for different academic programmes shaffibe in accordance

with laws for the time being in force and the fees structure shall be put in public domain.

(1) It shall be the duty of the University or any authority or officer of the

University to furnish such information or records relating to the administration or finance and

other affairs of the University as the State Government may call for.

(2) The State Government, if it is of the view that there is a violation of the Act or

the Statutes or Ordinances made hereunder may issue such directions to the UniVersity under

section 51 as it may deem necessary.

( 1 ) If the University proposes its dissolution' in accordance with the law

governing its constitution or incorporation, it shall give at least six months written notice to the State'Govemment.

(2) On receipt of notice referred to in sub-section (I) the State Government shall

make such arrangements for administration of the University from the date of dissolution of

the University and until the last batch of students in regular courses of studito1 the

University complete their courses or studies in such manner as may be prescribed.

. 49. (I ) The expenditure for administration of the University during the taking over

the liabilities of the University under section 48 shall be met out of the Permanent

Endowment Fund, the general fund and the development fund.

(2) If the funds referred to in sub-section (1) are no; sufficient to meet the

expenditure of the University during the taking over the liabilities of the University such

expenditure may be met by disPOsinu off the properties dr assets of the University by the State Govemn. lent.

50. (1) Where the State Government receives a complaint that the University is not

functioning in accordance with the provisions of this Act. it shall require the University to

Show cause within such time, which shall not be less than sixty days. as to why the University should not be derecognized.

Development

Fund

Maintenance

of Funds

c•„

Financial

Condition

Fees

Power of State Government to call for infonnat ion and records

Dissolution of.

University

Expenditure of the University during dissol Lit 1011

De-recognition of

the University by

the State

Government

image26.tif

g -.—‘-v—’~ ‘- ;wj—i ill—v 14 A: :u- 7~ wrv: -' ; 7"; ante-m- - - A; _._.._. ”31-4—3, .A 4: ~¢wcww mm,‘: 4 “gawk-mg»: an? steer Wt we, 24 Gift. 2015 27 . (d). all contributions made in this behalf by any other person or bodies which are not prohibited by any law for the time being in force. ‘ (2) The money credited to the general fund shall be applied to meet all the recurring expenditures of the University. I 43. (1) _The University shall also establish a development fund to which the D’cvdopmcm following moneys shall be credited, namely :— (a') development fees which may be charged from students; .(b) all sums received from other sources for the purpose of the development of the University; (c) all contributions made by the Trust: (d) all contributions made in this behalf by any other person or bodies which are not prohibited by any law for the time being in force: and . . /- 4 E (c) all incomes received from the permanent endowment fund “ (2) T he moneys credited to the development fund fi'om time to time shall be utilized for the development of the University . C‘ 44 The funds established under sections 4] 42 and 43 shall subject to general supervision and control of the Court be regulated and maintained in such manner as may be prescribed, V . . 45. The University shall not be eligible for any grants in aid or any financial assistance fi-om the State Government or any other body or Corporation owned and controlled by the State Government 6 '1} 46 The fees charged for different academic programmes shall be in accordance ‘ with laws for the time being in force and the fees structure shall be put in public domain. 47 (1) It shall be the duty of the University or any authority or officer of the University to furnish such infomiation or records relating to the administration or finance and other affairs of the University as the State Govenirnent may call for (2) The State Govemnient. if it is of the view that there is a violation of the Act or the Statutes or Ordinances made hereunder may issue such directions to the University under section Sl as it may deem necessary. 48. (1) If the University proposes its dissolution‘ in accordance with the law governing its constitution or incorporation. it shall give at least six months written notice to the Statc‘Govemment. ” (2) On receipt of notice referred to in sub-section (1) the State Govenuncnt shall make such arrangements for administration of the University fiom the‘date of dissolution of the University and until the last batch of students in regular courses of studies-lief the University complete their courses or studies in such matuier as may be prescribed . 49. (.l) The expcndiiure for administration of the University during the taking over lite liabilities of the University under section 48 shall be met out of the Permanent Endowment Fund. the general fund and the development fund. (2) if 1110 funds referred to in subsection (1) are not sufficient to meet the S‘Pcnditttrc of the Uitive.sit\ during the taking over the liabilities oi the University such e’ilitcnditure may be met by disposing off the prepcrties o'i assets of the Universitv bv the State Govei’tmient. 50 (1) Where the State Govemmctit receives a complaint that the University is not fUnctioiiing ui accordance with the provisions of this Act. it shall require the University to Show cause within such time which shall not be less than sixu davs. as to win the U ivcrsity Fund Maintenance of Funds Financial Condition F ecs Power of State Government to call for information and records Dissolution of University Expenditure ofthc Uni\ cisity duiiiiF dissu iiiion Oc-rccognition of the University by the State Government

28 ri 317H1T.11701 WO, Z, 24 ZVI, 2015

Power of the State Government to issue directions on policy mnners

Status of Assets' liabilities on dissolution/ de- n:cognition

Power to remove difficulties

I

(2) If, upon receipt of the reply of the University to the notice given under sub-

section (1), the State Government is satisfied that a prima-facie case of mismanagement or

violation of the provisions of this Act in the functioning of the University is made out, it shall

order such enquiry as it deems necessary. (3) For the purpose of an inquiry under sub-section (2), the State Government shall

by notification, appoint an officer or authority as the enquiring authority to enquire into the

allegations of violation of the provisions of this Act. (4) Every inquiring authority appointed.under sub-section (3) shall while performing

its functions under this Act have all the powers of Civil Court under the Code ,_ f Civil

Procedure. 1908 trying a suit and in particular in respect of the following matters, namely:- summoning and enforcing the attendance of any witness and examining

him on oath; requiring the discovery and production of any document; requisitioning any public record or copy thereof from any office:

receiving evidence on affidavits: and any other matter which may be prescribed.

(5) If. upon receipt of the inquiry report. the State Government is satisfied that the

University has violated any provisions of this Act, it shall direct the University to make necessary improvement and suggest for proper implementation of the provisions of this Act.

(6) If 'it is observed that the University is violating the provisions of this Act

continuously for three times the State Government may require the University to show cause within such time which shall not be less than two months, as to -,vIry the University should not

be derecognized. If, upon receipt of the said reply of the University, the State Government is

satisf -ri that prima-facie case of violation of the provisions of this Act, is made out it may

deiecognize the University by a notification published in the Official Gazette with prior

approval of the University Grants Commission. (7) During the period of. the management of the University under sub-section (6)

the State Government may utilize. the permanent endowment fund, the genera fund or the

development fund for the purpose of the management of the affairs of the University, if the

funds of the University are not sufficient to meet the requisite expenditure of the University, the State Government may dispose off the assets or the properties of the University to meet

the said expenses. . (8) Every notification under sub-section (6), shall be laid before both Houses of the

State Legislature before implementation. The State Government may issue such directions from time to time to

University on policy matters not inconsistent with the provisions of this Act as it may deem

necessary. Such directions shall be complied with by the University failing which the State

Government may take a reasoned action against the University. All assetand properties including permanent endowment fund, general fund or

any ottlerr,,fund also the liabilities of the University will belong to the Trust in case of : .,e:"

dissolution of the University under any clause mentioned herein above in the Act. t

co i (1) The State Government may for the purpose of removing any difficulties,

particularly in relation to the transition from the provisions of the Uttar Pradesh State Universities Act. 1973 to the provisions of this Act, direct that the provisions of this Act shall

during such period as may be specified in the order, have effect subject to such adaptations, whether by way of modification. addition or omission as it may deem necessary or expedient:

Provided that no such order shall be made after two years from the date of

commencement of this Act. Every order made under sub-section (1) shall be laid before both Houses of State

Legislature as soon as may be after it is made. No order made under sub-section (1) shall be called in question in any court on

the ground that no difficulty as is referred to in that sub-section existed or was required to be

removed.

image27.tif

28 Power ol'tht: Stall: Government to issue directions on policy matters Status of Assets’ Liabilities~ on dissolution’ de- recognition Power to remove drttrculties am who stow m , 24 Gift, 2015 (2) lf. upon receipt of the reply of the University to the notice given under sub- section (1), the State Government is satisfied that a prima-fucie case of mismanagement or violation of the provisions of this Act in the functioning of the University is made out, it shall order such enquiry as it deems necessary. (3) For the purpose of an inquiry under sub-section (2). the State Government shall by notification. appoint an officer or authority as the enquiring authority to enquire into the allegations of violation of the provisions of this Act. - (4) Every inquiring authority appointed-under sub—section (3) shall while perfomiing its functions under this Act have all the powers of Civil Court under the Code if Civil Procedure. 1908 trying a suit and in particular in respect of the following matters, namely:- ta) summoning and enforcing the attendance of any witness and examining him on oath: (b) requiring the discovery and production of any document; (c) requisitioning any public record or copy thereof from any office: (d) receiving evidence on affidavits: and (e) any other matter which may be prescribed. (5) If. upon receipt of the inquiry report. the State Government is satisfied that the University has violated any provisions of this Ace it shall direct the University to make necessary improvement and suggest for proper implementation of the provisions of this Act. (6) lf'it is observed that the University is violating the provisions of this Act continuously for three times the State Government may require the University to show cause within such time which shall not be less than two months, as to :t'hy the University should not be derecognized. If, upon receipt of the said reply of the University, the State Government is satisf 'd that prima-fncie case of violation of the provisions of this Act, is made out it may deiecognim the University by a notification published in the Official Gazette with prior approval of the University Grants Commission. ' (7) During the period of the management of the University under sub-section (6) the State Government may utilizerithe permanent endowment fund, the general fund or the development fund for the purpose of the management of the affairs of the University, if the funds of the University are not'sufficient to meet the requisite expenditure of the University, the State Government may dispose off the assets or the properties of the University to meet the said expenses. _ ' (8) Every notification under subsection (6), shall be laid before both Houses of the State Legislature before implementation I Sl, The State Govemment may issue such directions from time to time to University on policy matters not inconsistent with the provisions of this Act as it may deem necessary. Such directions shall be complied with by the University. failing which the State Government may take a reasoned action against the University. 652. All assetgand properties including permanent endowment fund. general fund or any otli‘e‘tighfund also the liabilities of the University m'll belong to the Trust in case of dissolution of the University under any clause mentioned herein above in the Act. 53. (l) The State Government may for the purpose of removing any difficulties, panicularly in relation to the transition from the provisions of the Uttar Pradcsh State Universities Act. l973 to the provisions of this Act. direct that the provisions of this Act shall during such period as may be specified in the order, have effect subject to such adaptations, whether by way of modification. addition or omission as it may deem necessary or expedient: Provided that no such order shall be made after two years from the date of commencement of this Act. (2) Every order made under sub-section (1) shall be laid before both Houses of State Legislature as soon as may be afler it ts made, ' (3) No order made under sub—section (1) shall be called in question in any court on the ground that no difficulty as is referred to in that sub-section existed or was required to be removed. " 31,4 it at

\i.tn Walt affIRTRut ivtd, 24 V 2015 29

STATEMENT OF OBJECTS AND REASONS

With a view to encourage infusion of philanthropic capital in private sector to participate in the

.field of higher education and encourage cdmpetition to attract high quality faculty and students and

continuously enhance quality it has been decided to establish and incorporate a teaching University by the

name of J.S. University. Shikohabad, Firozabad. sponsored by Shri Jagdish Jan Kalyan Educational Trust,

Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Trust Act,1882 so as to provide

to the students and teachers the necessary atmosphere and facilities thiough proper structuring of courses,

new methods of teaching and learning for the promotion of innovations and integrated development of

personality.

The J.S. University Shikohabad, Firozabad, Uttar Pradesh Bill, 2015 is introduced accordingly.

By order, •

ANIRUDDHA SINGH,

Pramukh Sachiv.

ARrii010410-70M0 246 -25-06-2015-(516)-599 LIFd111-(0“4tVa/3111:63kU) I

.1.11-0V90/100-R01110 6 TITO ibTri1'I-26-06-2015-(517)-500 L1ItPtITIWZI1-(4044/t/31716t1Z) I

image28.tif

I l mfimwwwm. 2411a. 2015 29, STATEMENT OF OBJECTS AND REASONS With a view to encourage infusion of philanthmpic ca‘pital'in private sector to participate in the field of higher education and encourage competition to attract high quality faculty and students 'and continuously enhance quality it has been decided to establish and incorporate a teaching University by the name of 15‘ University. Shikohabad, Firozabad. sponsored by Shri Jagdish Jan Kalyan Educational Trust, Shikohabad, Firozabad a ‘not for profit’ Trust registered under the Indian Trust Act,l 882 so as to provide to the students and teachers the necessary atmosphere and facilities through proper structuring of courses, new methods of teaching and learning for the promotion of innovations and integrated development of personality I The J.S. University Shikohabad, Firezabad, Uttar Pradesh Bill, 20l5 is introduced accordingly. ~ By order, - ._ ANIRUDDHA SINGH, . _ Pmmukli Sac/tilt . ‘ fiowoidéto—Qofilo 246 W—ZS—IOG—ZDfi—(S‘IGFSQQ mar—(W /éi / 311W)! V WWDYLO‘iIo—vofilo 6 mo Earth—is—oe—201s—(s17)—soo with m—(m/a/mw

  • 00000001
  • 00000002
  • 00000003
  • 00000004
  • 00000005
  • 00000006
  • 00000007
  • 00000008
  • 00000009
  • 00000010
  • 00000011
  • 00000012
  • 00000013
  • 00000014
  • 00000015
  • 00000016
  • 00000017
  • 00000018
  • 00000019
  • 00000020
  • 00000021
  • 00000022
  • 00000023
  • 00000024
  • 00000025
  • 00000026
  • 00000027
  • 00000028
  • 00000029
SECTIONS