M-11-74"Carr-176
. 7ritt417 .11-W1—TfIcicrffoli1ofVFo-
5ccio/790:110-91/ 2014-16
1-4*19i thZ Ylief
41utd, kirif fri47
397vkfr ic RT WQRM
?Ai tiRiiitc
qpji, tqus (w)
('3t1' ar ai-M=4-zni)
eIN-107, ik4c11,1, 24 ‘ff, 2015
auttr-q• 3, 1937 71- 5 Tlizfq
th-ctl !az!' viva
itInft artTrir—i
Ti3YIT 645 / 79-M-1-15-1M13-2015
eit.gith. 24 ‘-9', 2015
3TRRFT
fdfdkr
mi #F4E1N" arl—a 200 t al@ uvqvici 761-47:1 a.0710 1qEZcicjq
itARIFC, R)a1/4r0e4iq, Maqf iNtIT, 2015 ITT d5 23 7, 2015 ault Taff t
Tfft Atki Ii!seff 7 2015 kFiret rff airq79T WOW
itqf vricir t I
99DtaiciL1 010161641‹, 14)auliwic, ‘ic-c-P(1471. 311iff21li, 2015
(\int< Walt 3TitTh F79 2015)
ft-fir 1/41t-cpr IctT faU17 giusci 510
•
rilftff pin
wrast WI oetouf 6141q, f4r0ni(ri< ft9T3-4174
, ttfrff 34frilf9. 1882 81019 4cticf "Ole tCt, o locincf waVF f -:61 1W31q1-41-q 1-314,16twic -4 srw 3it2rfq7 Wrged-C1174 7QT114U cin4 aft3 thLtor
fkrriko wf4 3t1 33,10 tlkfi1/2.4c1 Zif mar mESIT 4.)4
•
arfrfttrff
7TR1 '71Tirgiq4 wf cf 31rn.ftaTf 49RIT vllciit.—
1—trg 31RIfkiFf *criTO fagfatudit -111016141q, fe571W4R, ‘Iccti *If Tata •979 3Tikka9, 2015 Th—gf Wthif
act) 3:1- 1t 3177:12ll 31effft 'PT 3TRAVIT /1—
M jqftq j ur-o:Rf 1. xcriacircrog met %ANN<
•
(310 c41.4 wr wr-eTzi fayuldeirevi w-qtr 414 ait3 z4-4-qt zfr f$311
an 414 34. t;
is4S, RPH.Dme•I yie.zois
trNiid

smz-m‘ l-nm'udu «115 A A
‘ fé‘thézuazm
Mmmwwmmgnmmwmumm)
fgttawmaauemawgwam'mmwg)
M - wwwfilahwmmwflmm—z
Immlwslozmgm
mm lag]: alga 21:11am Emma-W 0mm mm mm
—1%WWEEWW§MM$W¢ML _
W '-
Msammemgemwsfimmwmwfiwmww
mwwwwmxgmmgmflwmg
mwawmm'gaéfiguma,megmgezw'WML.
nwgmm'wg'mmmmlmw
Um§2gmm222nhmngmgunaamgfl '-
(smzmtmmgwnga) . ‘
SLOZ'WMM'EM'MWMMOMQQ
‘ Iglmmuzsg
WMWfiMgmgmgsmzflzmawmgfim
_g21@§hmgb£keghsmzfia azmmstoz‘mg m_m‘21mmwfimg§ug
hmmgmomeggngnamumm$oozzgaikegzumggmmzmnt
m
SLOZ'Eh vz‘m .
stoz-9L($)L-9L—L-gl—sz/9v9 imp.
L—lzlhffle gang;
um: mgr: my;
lamb: 9m: test '2 m
9103 'h‘h :73 3.123% mum;
(W man ma)
(:2) m 'L—ldh.
WM"
a 2mm 2Q app ‘2 $3.511»;
9L—vLoz/ Ls—oumom/OEE
V wm/omomOM—Lm: Mr
A @
gzL—m—m
-
2 ( warsr 3rTrrs1rTur , 24 , 2015
(Tr) cfAcli , Vit—cgc,11 , VatIlt" 3N. "ITI--cpflift mrr
.droTzf fara-erra-zr Z ca9zr crprDurf? , uRr—crpiR1416 , Tatrff- 3th
..srra—ctrprf t;
(Er) -Fir' ml iiwzI fzci14are-yr t t;
P44)/umr4 t trier , sath
trzruff zrr 3t1ErRtrit 4 *Nli tikr .m-R1 cr*)' crinwr trg ff4g-ou
&Ayr t;
() "ffi4trirs' ml 11Wd 3114719 fbTrir t 3th fas9-4 arszitm
31-57#-IN t;
(u) cp.itriqt rur-o-rzt fdcavarcyrer iiThEr4vr fiW#arfti t aft
fiiw f4c1vieiti 3rEirmzr- -Err co4tria Wf *arr r Ic* flThTf1cT t;
(W) ct,i4qRc i ur-o-4-4 ftraftr-dzr rzf trft,r4 g;
(sr) 14Nrirr Trtatireit ml dwit TrtlfW1(10 ITT 1+21-1 t
zzimirftrT Pam 74-r9 cNcir UtIT friflk fclfaucriq ed749-
TIRT tic11-11 d241 &Tad- IRTT113. t;
111N1ffaxuRvietzr* tict)14 t;
(3-) Ist,1141€ Th-T . Uffcrzi RYcl1411(14 t71)1741/101,11 to1,1141t1
t t;
(3) "RtalT/ 1-161 Vida ml 1TT4 f1cPii4 IIc iftra
zrr Trarr t *tf 3AffiEr4 ath liftzrrri 3pDrh
fcrPviclir gkr WIT143 ZIT 3T-Tau TIT 3WFk ti6Thl T1 ZIT 394,1-
tIt4 ch er;
().. flra" urdirri Mitrff t:
(U) " 31-ftat 3t1 V Cr r r91mr urNzf cr wcriu 34iff'd
t;
(7) twit) fltkl ml 3WI4 TTRI—trig tiR Th\--417-1 TRchk. TT 1
7-24-flu -S Thm-R4 t, zrErr M-Vqftti 311-a9- arizbr ath 9,kic
31-pfic arrF WP37:1T Thlf4Ta. 175TR. ja149-Wa UjCJ9., Tv mitta arrcit I
frbthl
1 CIEck4r9 Oft-a. s4tc4 eftr aircF -PsErr,Pvi ift-fri mlfThra,
41%'-ctio tilfti aiiq,tigErr, ksITS Oft-F tr.17vir );--S
:c1.!
cf). 1ftei LbN 1Uzj.cAttft-19, EFF411 k eitic9,311.14i '11)3Eri IT1 g;
,
(e1-) "T-IRP14-111- 3th -3-TalrOtmi 311-tf 3N-Przi str la-strfaErr6t trr
t-rrzr icrinz-r4 ath 3ts2irer 1t;
(0!
(Er) 13-r w-ecrif ffircrear-trifFzi ftrrec tC-il ThT# 13T
(") -ibefric-14 31azITEW" ml 37:rd 3T1'EIR1, ‘341iTRI,
tt.R745 arrirrzi, slisEmro, 3th t R,Fg f%rricritr
ftlalT/1791-Fur MCf-fTh7-4 TIT 71-1W 39.--TitrITI c ft9T, f1R-1-43 fOTT
342IthlY T1 arsirri *14 4 ,T4-rf9;to- frErr
(sr)m--1brrEtrai qc.1dficr" rq .cric.ftrThrr. • ME-ic
frftl.,FcF Trffwitris4tr crAcitYik-N, Zbl arTril
&maim, cr3eitrior, ‘31:1 ,143,71,HRIcf. thfff 3arTh-r, EiT fitzFich,
T:r9ThlairlaIET TIT c;jc•Ifral-TT t;
CI i; 4 KI?IID lIt IV I d I •

2 wfimwwwm14wlo1s
(:1) 3311131113 "um—W13", 33—11113" 31: 1113141331131" 311 '1'”
1113121 13331113113111 21% 351121: “W113, 'm—W "213711113“ 3111 l
”913433711113”? 3; 1'
(H)‘W'zfi13fiufifi$afimafiw113;
(§)NW/WWWWWW,WWW
3mmmmfifiwwfimm$w3§figfi~
31131-11132
(31)"W’H11Wfia1mfifiw1133fi1mmmefi3
WWWWE‘;
(11) “W"Wamfisafimmmfigfimwfiafiéam
Wfiwfiwaanmeafizfiaww 111141111313;
(U1) "21112111fiu3"a11311t121fi1$31fiamzfi131121 W‘fié;
(31) ”Wfirfirénau' mafifinmmmfim1fi3vfi
ammfiai WW 217—1111 3 am WW 7113312171 36111 6111‘:
mamamafimmmfia‘s‘;
(31')W"‘cfi131q11fi¥afi3113121$1131111113;
(3) “11513113111 w'mmfifisafimmifivhwfi/m131mm
11%;
(3)'W/2131fi3113111“2171 11111111 133111111 1131133113111 11133 Q11
mammwfiévfiwaféfimmqfifimfifimw
mefifimwmammmfimmr
11m 31;
(31 13133” 1111 313111 ufiffimfi 3111 131311 11 3:
(3) 'WWW" WWWZBMWW
11111121111 11 fi;
- (U1) ”Wm—=11 111211121” 2111 313121 31121—111121 111 21135111 11111111 3111
3.111% 3113133 W 11 3, H211 WWH 3133111 31121111 3111 1311111
31111111 3113 31113111 251%?1 rm m1? W111, €111 31111111 311111 31315311,
@1211 31:11:13 $111131 3331 «1111131 311111 3133211, 3 31632111 111111 3711113 1,
111M161 611111111 31111 3193211 #31131 117111111 11711? #1311 QTJEESFL 11:31
(111611161 1511 91113211 21131113 111111111 6111121 311115 3193211 2112
(11) ‘ufiflwfi 3111 “3112113111" 2131 1113111 1111121 L133 Iawfawm t5?
£51121: WW1 3113 awfiwfi 11 3};
(£1) "11131“ :51 1113121 13311133113111 21% Yfififx’ 11' 3‘1 W11 8'51 11 3; '1‘
(3) “13311135113121 21‘: 3122111131” an 11111111 31171121, (111111121 111' 3113111
11312135 31131121 1112211113: 3111 $11 3131 62112111111 11 3" R173 13331312113111 111;;
131811/ufé1a1v1 $1313 373% 111 31121 11311313 211—13 :5 m 1113133 @1211 mm 3.111
awfifimmaéwfifimfifimm;
(u) "manna", "=ch"1!‘1114£|", “1111 1151111qu ”13m 31111112111", "1151811
9121:5111", Emma :11 'Ww‘ 211 6113121 13331131111321 25 3131121: 3":
3111111211311 2137131133 $1 33111133 1331 31121112111, WET 171131211 1f
31113131319151 :11 13311311111175 11 3‘: 3 “
. ' 1g}
:41 KPH 11-11;. 1 mu Z111: » 1g
ZIR(Ft'YT SITTITIT c, 24 ‘11,1, 2015
dMill 31iffIT,T11, 1882 3149 fiqci
611 UTff tc1P3T ffcb'h5i4i< Rrih,iiciiq, 'aT1171te"
OLe t;
(14) -Th-seraTT- Th-T ST '3 31}119 TaTTfte tOkRiO
jcI[ EJIclT ftrt-itT4R, kicci•Z IfTbr t I
3—(1) 1rtii feff qrtMINTq Nick-1,4 Iftte A nhazr IT 3Tgl • LK 1882 fthar4vraz
349 ti—a7 4t 71-11vi WargiR, Thnl Te111171F
td gre rit0KT-e0 I cIfc1lc14 Pit)5NIC, \35kttyraTa 979 3-1
Krw faxcriaview met TerizrAT Tz)-Tft
(2) faxcdacrierzr \r- .1-4.11Acr Thm-rzr Pii
4—td. 13ft Altilutch f24M-RI t, re 3TMMTI 3Ts1119 Yci Ttiffle iazi
4)74 AZt791 A Th...ifgtqcr Thati -ip.mrqr
1:Erg vid
(W) "in.44 io.00 mt-q mat wiz?' Id.-zotr fARr mat wrzrAr met wilt;
(R3r) fasaikrrair ftita. Ro-dri 40 kt4 14 •<.44-k .14 grnd
15I IRci i<firacci e,
.(Tr) 331-Er& (u) M flftrz ci wq A WTI 24000 Whii-23, cbi•Zt)? IZRLIT
if 11-C-9 MR mtri ftrz,r4 A Roar( 50 AMWffin 31:1thiT ttfuri4 3ftz
crsiffrekm sralcnl: A Rip) fm-zo qrriAr;
• (Er) wirt- NO A fAltz 1T-4* tujkiz STRNT4T1R134 q iii
444 *1144 •c•41 ‘34 to( 311ftelli IT49
jaraiturnr .zpzir4 aerr 3rRT.uzr41-ar ath 1h wzrthrizr i1r91)41m-zr met ri.17f1
MIT 3ITTITT11 at 4 WE •TR' ctra4 \'9,4 4) Ikcett tr41q7
arrferat mzr aza-farcrAr 3j120.Trzi RA-4-or (u) 4 ‘31Z.v1limcr 1Taff t 131Wi]
MIT SI 31701/4re4 317 th" 311311vt4 ei•aqi .4,.<4 Th.c cycm€14 vlzrr;
(u) sraTm.fAATA zrr WRI1T MTI KIT 3T1WRI, Tr&arrq-rzt mir
allwrzi 4) WI fttiWi COM;
(ET) IF?! q, el LI wr 4-e eilu ti4A1lTr-M 4rNm-14 in mzr
fm-zrr oru)Ar iitu Wan dn ci41 AzafM'A
T?.1T 311. 1tftl 43PIT1311 tn7ffil irkT 71T-4 '<nqa Thnta ct"')
Thn.t Mci•ig4c11
(U') ta-r- zrra,zr waf z.4 zraT Ard1Wrat. Ar4zr waf m79
.; .ri fatTi, ara-faar ;r•Acyrqr4r aer-v, Azfrzr tar
N9-gzr\-70 azu 71rcc1il cAad (b), (VTAitt) Thcl WtarriA Tha5r0
AirrmI orlzow ZAZIWT ct).) Met crel-1614(1T -011;
faTathuTeizr arian 31RTYTI (101.A1.). o4tg-6 Arreta viRw %err
'•ARtrz: aih Ara
in ti r lfZ1T1 .31,
•
11 R4E4IUNT
rtztorrzil gTRI- PIORa T119iM RI11l 911 .Thel vat;
(T) fittingti M wrivftift fq AfAza.M14 met ztitzru uzar 31.1
ThaniTimit thrIT3ii ThA 3:ted-d• cm4 in twrd TIRT4T; •
t• TreaUTM.1 crurzTA oth ti-cocirr f&A zrRftrarr 417 34zz4rezr
-T1171:
.(t) fatrafficrierg gr.6 4r T:r4 cr, 4 t 0 view arpm airthrr
7 1:4:1 fAnarr- rcurpti arf0tru;r %karrra-a1 zrAmAl f4-;A Aft
•

Hm m swarm TIE—C, 24 5m, 2015
4!
(H) we Fm HIHni NRHTu HIIH am 1882 H 3121171 Vfileg—d
fiWmmmWw,Pmmmmm 'Wfifi”
Wb;
- (w) "fiafimau" a?! Hm aim '3 $ 312117! wfihH frown
WPWRMWWWWIHE‘I
3— (1) )firifi’rsmz WWMWWWH°WW3®W 1332
Hmmmmammmw W,m‘rnafi
HWPH” mmfiowofiwfiammmmmm szr‘z-Hmfi
wfiwfiafiuafimwfimfil
(2)13WWW1WWWJ
4—m,vfimmfiafiu%,wmfiw$mfimfimmm
HfifimfiHWfigfimmmz—
(as) scram‘oomaammmmmafimm; .
(meSHfimHIHQWHLHHHwWWLfiHjfigé-mm
mwfimmfiafi; 1
(70m(wfifif‘a‘lzogfiwmfimmooafifiiamdzvfim
vafinimafimffimfifiwsoufismmmfimfiafi?
usuHPfifi uzfiwfia‘: m 137m Hrz’nn;
~01) avswflfifi‘tzmfimmmnamfifinfifihw
WWQEHW,W,W,mmafimm,
'mmrgfiaflmm-Wsflvfivmmwafififlfl
mmmw¥fiwmmmma§wwmwfim
WmmwgmmmyfimtfiHWHfimm
wmwfiwsfiimwfiwmmm$mmfim
(wmfinmmwfimfimwmjfiwmw
unifiHmfimmwfifinmm‘rfigmm;
(mafimfigwmmmafigwa‘éamsfimm
1 »Wmmwrmmafifigfifiwfimfi,mam,fiaafih
ww.mgfimfiéflwmmmwfifiumm
vafiamifi‘fi;
'(fi)m$,ffiqmw$mnfifim.mmififlfi
. JIfoHf‘am’, arc-flare WW W11 2mm, may} mafia Hm .
» 15":lflmql (WWW) Hal W21 $33 2m (@1111?!) a fiPmmm Pamfi a:
': ‘IIIHHfi iii sigm‘ tame“ HRH Eh"! WI E‘Ffi;
(50193313616111 3am 3mm (qvfifl’fl), m man wfim firm
-"-1_iR!u'd (\ 3mg mag) efiq Ef‘w-“a 2n WW MW Em mm an: Hamm;
' :‘fl‘emzfi gm {Huffia WHEY vista? 21% 11% 3‘?! WM}; ’
(31) fisfifiiflm a? 251mm :29 m Whfi ea mm Han 3W
Wm 13mm 2m mm W "or?! am! afar; -
(3t) mm 23 WNW em Ham 2% m wfian 3m mane?!
,‘ '.'v:
"(flfiyafimmafins‘mmmfiwfimmmmamw
aamfafimws—mmmfiwwfimfimmmfiffifififi
Him _
Qumran
5‘?! mm?"
mammal:
m mm a‘:
m slfi
fasarazaz iii
311'el
f-43albaa1 W
‘itt4744
Pt4T 317IRTTPT%MIR, 24 ‘7, 2015
zci 1:117-4aVff1iuf TI-4TF-4 tg Thf471I94) (bit 1;131
mita
znite-mill -tre--mw %main;
(01.444 *New4,--rm- 191t4ffil 34.-d7Ta tR 3t-01ra <MI TI71 TIEM
117
3r41 ZtiffetT wra411 atat;
4A1 3474 stJ fa-94 faxafauraw 4 wra-ar W tka ftt
Thc1 31.41T touir *Nchr( KTT Thet viI41 I
5-0) •tiutf •1-NOK URI fa7cIr41Ic1LI
ffig
ATRWR tr5 aft f44q .11,1W aro-ra faxofatocro cra1a7 3117121
cr)Ilf I
(2) •I•Ttl ti•tc:oiC ct.d 3TRR1 T1 31fira4 iittU 3RihtEr
VIT41-11 PRE
traRi URI 4 -Fe& arg w3 al 7-4 t 1TIRIVIR
riTit M-7411
6-fa-rem-Ka i517--q-aaa faso 4 WI armait -41 1-1t41 1'4
-ra:cur-az/ ar
31Ta71, tT 3il3 fawn -33K711 lottraa araiur or<o1,
WT [td Wlvra ii
31Thgt etr<-11 514If 3117 faxofacimo 134-47I att3 ararra4 f*-1-Poitia
crt-4'a faq atragrw ThcIiOT a13 ara TR@
44.44 wr ;Rut a-414o:-
(w) firer! 31 Sr ormr 1=3331 tuckoo,91
tTrtko-rt, 319.11'R
110TERT 3117 sliffiuk, ffi rRare Th-
Rit sivuuk fkw 9I411
31R tO 3T-41 t -141-1 Wet 3t7
caud 3117 7E177-/
14ifffm :n-4143mi tIct;
(Tio falt VITUS NUR@ Thtt al-Gr
(TT) 31. 7118171 31a1/49 S1 at crwii,
(17) .4141 k;,61,:twii, grim-goer-di. twii
tv-Ntior S 317ifilleRI
\T Aftwar 4 am: FS-MI
Mse4t4c14 4 7—Rxcipacitiim
1:4271Ntgct tif Mi. 1'31 *icor ft14W91010t)
3fN
.<1 'LOP( gRT tau Rxo---17-ba 341-3 4-osichl W
319-117:-
M idea 4 tit antral k frg- taxofatoclo *No -ono 73
arwaRa-
wk, f3m7 WI azwair aror afi-3 7fltr W MT ui 317 Sr@
Mr)" 31.51cft
5 U'aT zti fAtitm u1-07211 cM-11,
(7K) ftM, 3TRITIffW (td ThIWIThrt
, ta4Z/ctif R iit
3111,4-017, t -11.44c-or fo-ar7, 31R1 lliT 1t0T9 too,o
,p4r faDitecr:
\ifZmfbct 7t1 t. ga-att, au-sta, -41w41, -034#13411,
ta-3143.11, Ricg. asj
fewair ?am, writ, writ, ant, 61cer srd ant=
v47r, &
cic1
al
701:M 171-44-V1
wi, tii<tzkf, otPivo, 312.1111Te31, 111T
71-17, feat 14,mino1, fewi,
*It, war, 1rtf13 ftrat ailft
W14-dfl tR fatiraPos URT tivr fa113ocr 7-‘14
,44+4. 31-11F-ta171.
Yr:54117 W17-7 a t39 W rata7 t 3174 faqo
iff <;.-C titii et
31P-1-41 T7Q.T flrea (4,144041- auk \Ito thIbnwi
14.4tortaa
tou-trro tr3 fe4a-aa favAT TI1tZ111
91ifff tRR cM•11 3117 39-4
311;11tril M-791;
(7) ftarfaal ta3a4-ra 34124474 4 calt-fa
\'ffiftawi ar -w-Tio
tiaina w37t;
(tr) W 34117 3-6t
Thaafauraa ataarRa w1, wfbtal
4 titan, irt4iorr ar alien 4 fw3t 34-
74 qi1i W anan t17 1. 1-cti1+11
TRiful-t1-5 Stall 7-a1-R4 at- r tTfiTh factrza4 cr-4-r9
4*-li 3117
ct>10ft 4i4 ArcruTC1, 3CREtrZil
teiRr43 Wardi3t
MEM *ffi;
240 KPH Data I Vid-2015
).

m warm 71312.24 5132016
4__________31____,__’_—'—————— A,
(afiyafimmu 2% WW? Wmfififiumfi fiamfi am am My
mmfim‘iafi "WW W'Wmvmim; _
(ammmfiwffiamf—IWWWWHQMW
mummafiwfififimmfifiwfiffi;
(QWWYIfiWWWEQWZEEdIfifiTfiEfi
2m mmmvwamafiml
WWW
sum
(amalmawfisvmmafiraufimasréfimwmm'
W$W%m4fififiewnfifimfinéfi,mmfimm|
m'mmmmmmammmmmmmmw
Wfimmawmgfimfimmfimmmz— ‘
(afimfimwmmfimfiafimmm,
g
i
3
i
3
§
3
i
E7
filmfiamuafi 7—
am -wmmfifififim—fié¥fimmfiwmlmme
:3:
9»
3;;
é
a
3
:1
37
31151qu awn; 4 V
(Infirmafiqfiqmmmfiafimmifimmfi 12
WIND?! 25w;
‘3-0,1 31-€1STRT quid, 24 ‘7, 2015.
(z) fd120 R) 411‹ wqrf0-4 zri 3T-1CON 14<i-f
(zi) 04 ant-let m*. faxafklIcitl ,(14•W t; ft:rut mu
crfteivi A-417 cb*if 374/Ta• 1:15MR 30 04 304 tliqqa*I 411
(0) Mr410.11-az1 gkr ar4fw Thcicb Trd, ;SA c , 34--4r4 trd,
31U311t4141 IR/ \iwitil4 74. ti6i4ct) 31r4r4 tR, muuqzi WC 30 301 31tiricrff
&PRi Ig1,49 ,<1\41.4 *Ncol.i ThAwricrItil ar-1-3th
Tifkro cmdr 3th 31-c cm-1r,
wzthrtetzr, W4woffizr 3th ar-r Tra •41 ctreg mrr tr7
Thflkiqi cfrmr;
it-41 ar4r zci view irr ii410-1 wth-d tñ uncle& 1r=i
fdftre -o-r9 7P-4-211 wcr zrr ff+-41 falWtd ara feq 0.0-1
Z11 0113q eiqfrif;
"thr ath Rthr Sft-A am:r xci ciievr zrr wffizrr Ti-orr
tin tIft 34'17 cP4-wT u),Hr qz(11441c14 31AsTrita wt,
3T-0-14 qflur ZIT ‘i•icbl \I16TM ctrMi;
(Z) Yaw atti. ftar S ftq 1jj3,ci,j fljtq,çç 4irrierr34
wt-rsti. ieTTA9Taftn arliaTuf cmlf tiftRxcif4c4iqw,4,wzr 4 -u-fr*
wa-tar 4-344-frz cm.?5 1Ik arrthw
(u) 3ittifirffei, aiicjRidI, efica cr141. 14<ch 30 turftdfifW
Tiftem EM•11 311i ;(4-r9 ctrHT;
(z) fthermll S344M &wit,1Ilc4Itif ii -Rw49-r 31-53eTui
‘3101 vITT WF5iYkr4 St= "q iiffireif 30 till-H-4
chetiful Q,jujØpjlinT1M-FTM TernifiW ctr<41;
vntr afr itirT411 tmf3II S u4tha r 3ft7 ‘ictri
3VZTwiwratf T tifl Svatr arwerr 4 tift-&cr zfidr
zc,•a i 31Iq4cl, ii4151;
(13T) 1-1Rflti44 3170 thrr -Nit <bet Tiwr, f4-144 zrr raw u
-Enthll co d;
(u) fxe4 wog 4 14 gf S T4q z -sr tt TIPTORIvg S TIFTThi
ar-gth fkrfftd
4-11 fZiutar4Tru trfterr re4144-r trr -4-41eror itt cr,) tr7‘f
wwidt *;
(21-) -4-fr zth 3141 u4rt 4 TOT 0,411 30 \I-Dbf 1jTaT9 AI ;
M lift-draft 74. 3021 ci iTRI--#T 4 Pi q W0P-TT cMrlf trr
zci woo alto tigiSI;
(S.T) ft/catnelef S 44=400 AR vi - it 4 3r-grri:m faRtirkr
‘iiichf AT-69 cr,ddr 347 nr -ffir-4.r 4 th4 3740Tf. 41 c.N ITT
fth-dfd-cff-6-4Il 31icp t19Sl1 WiT ,
(9) 1thditvr--611 S o4tiiPdf*or 021 ath 11'44 chetil 1* iir-447
#, tem u.141P-11 ctrt•iT;
10-0ftureizaS Thc-Uii S friq --rd AN Th-if tr$-in
ni wffii irn 3bth ww. crwr ath f4R -R-Err tM ft; .

fume 10»ng age mm mm 14219 L02. gpmi m
maegugauemuegunmmgjglmmgnmmgaegw,f
timmmwg
wgmmwmmgwgmm (L)
.m1mmmm2nmngmg
Mmmwmflegggmfltzswmmmg
wmwmymwwaewmn)
WWW
‘mtsmmmwyrmaaewmmmwm
immwfimwmwwwmwww
away
waggmmanmuemlmghwmmwm
'@M$M/M@L¢EM$M§WM®
.muzaunm‘n=
@Mmmgma‘aewmuflw$ww(m)
fmmfiue magma“ :
wwW§WMM$mmmmmm
gwmeamuelwamwmmwwwwca)
519.12 lebrggngzgmng WMIM
MWMMQQmmgmmmémmmm
mfiwwmwwmmwmmwwwwmm .
nagmgngL-awemmga
& W w‘m 'Awhna; 'mfzm 'W (2)
’ famm$mmwm
mgmffi'mfigmflmfimwm ge‘gLSJg-g me:
MWWW'M'WwéfiWQWWQ)
fmuaMmmmnm‘
'M'&WWWM$WMMREWM
ammmmmmmmmwgmwmam)
A fmuuazhmm
mmwgwwwmammgemhtfiam
w'mmmmymmmwwmw (15)
mmg
whammmwgnmmnmmmmm
fmmaqfigwgflwwwa
mgwggwmwwwmhuwgm
mmmwhueughmm'uwma'ahmm/Ahmmma
'ahmm'ahwm'ahmwwmmwwmgm)
3w
mumbmwwumwmmmm
1122me agihmgmagmguauemmga )
immmmmwmm-amaama)
am He vz 2&1me .
6
3VR TitZT 3T-fritiRuf -1E-A-
Z, 24 ‘9, 2015
(L5) fa-SIMI * II-0791
feg "Oz * 39-4-47 "awl $1
via -St vrallit tw trwet zqw
AAT AT wfl atm Tam;
(a) TtiAt m SI fat 37..TR 1zR $ zrzirtru 31T
-44, gedfg5a &Rid
Sgiflittli, Nd(U1311, fdg-1-4, Th--aTWRI,
1:11-4zIWR
kEr4 aiR 01 31R1 vATR11
-$1 ?Art MR9-1
fel-Sall 34-kgr1 Th-\ &SR MRA
-1) liI1lIV7 IRI9
ThR Tr-- ;
(A) ant-041-91l VI 3TEll-lTh
31R SR Ikal -V 3TillW ThR711 ail itiAT
kii; aftR
.
(TO tA ar71 ITITI Th-cd 3IR
Th:g1 WT-41
%--t z-Oval tt
;AI fo-7 aawc4/P. 3Tr
-gem ziT Calln‘r 1
seavi ati
13-0) Ib19 tfa m-
rztwqi A crAv wmAt vim fat sil
-q fasS-dt
terf!M ;WM 3iT417 31TZ1)11
01,11 Al ArAe) t argrR itt wr?:EA 1
-
itraitzliati at Tau
m-kAT it fatal
gm fs4t Ti? tira:ZWril *
tift ATA-- fa/arra
-a Nym 3trztiT mu
3T- 1 S f4wrzi WMII:4
ftva-fx-bA &Tin t 1
3itat51- 39-clla ltreall-OTI 3T
-i-41-4 Vern iff
Mitt tritiq 1,
earr-Mvii t air a 1
,
T-cgAgra rfit Tit Ri
l ttift1T- fola0 Sr trlAit
vrA/Tw .
WW/ 3TRI f4arg- ffi-s-
rt gm fAlltitd ATASi TR ibaltarazi teifilr m
-rzil Si
trffa-trTra tri Triterr m-seil f2-
Wi 7- Natal' \rd aw 31
--- 1 CC-iLl BIll
WfrA t t '
CClfzi 71- 1 11-T-t--R grz
-Am fAr41z ftA 7rtit 1
,,,
31=5 Rr 31-4/
t fdtem iTatzt tem em
ti tft 3IR 3TRRI *1 lift
-A Ar t At tA atti ?mit
-wall gm amz) zi 3t kr
- ittaavaTaA “ tit tiro
,
-AfAft NA-141 t3A1-
8 %--griZrcrea srfgu m
-tTA 3113 wkr0 farecarFa 4
. 1A-1 A . '
striR yracizm miztarl tg
.S fat wird ft-
al wircti tili0 A fttir8 t-r- • .
crft (ASTRA gril -
A 11 ThlItagl aR.T Tatt
/W-aT IRWR *A 7RITCI
1 i .,
ftped-awl
9--TdItEret1 SIS frf, As], Tra, wit za a
-rt -“tert t Fe'tq t
-rri si17
• ,
,
.ipt wo13tri
Thearga fe zrg !Sam
At tra it at it-RA -afro * ffie
it(11 arRrm-M,
Tr-draaftErtil t 31141t1, Wl1 /2-ffiti
Ill UP t --
ct A zwl iatzt WI atA t M
.q zri wgzli Sr4 Era ,
I'M btu q-Rut .
ThRA * faq TR at t iFrd- m--T
I'M Wcri TTA -$ B-c-
ava t tirfit
. ,
-'
.1
?OW-Er AT WWCTEI .
1Th-t OM It tr, A
-CR BWI tR 3-aera tt
tri- trg it 31"-
Tilltd 71n711/317gt-U a-alrallV171.ftei
* 31.1 fitO
WII 4) al-WO
fm fAvaltcriali A at m.il m
-AaTftal a Adi 1cTR
.a.2.il Wt. ''
Kir A ies-r51 ird-
V1 IR 3Ther lifflSTR( IR -Cal TRTh
lR *. 31T-a-V11 TR-1
fe4afAv itat qltlIn 1
Marra-Li t
io-fdreaTIWI '$
f'a 3E41 3Titlt.t41 tl)':-
St (.) T2aarcrea;
. (730 sit T.,-FiRgra;
1
i
(Il) T,FITik
,
)
(tr) Cift ITh7gcrfk
(t) 1=4-a-zrraltrzl,
i.
() T,F a;
.. ,
. ,
(0) #m-ra) ilaitztai;
j
,
3btt1110mn I Vel-:(.15

:40 KPH ”am ! \M—zI-H
ati 5rkvir%r+ITEIRT 24 39, 2015 7
(*) zsm cpetiruT t-r titiznara,
(T) zten- Atm*,
Ta-r-gpat,
t.
a
(e) OTTRZfei;
(3) 1. crf 311t-71t; 3iR
(3) 3T-1 af071€1 gl7 Ycl T 3a1TR) ring
11-0)* ;mu *At gni t9- atf 3r-a-fM7cjIqf
fA.gfft* urr4711
. (2) p,eina arcr4 ERT, tItzrd 31/2 zu weft! zrErr9 6 id- ath at-er
01 q qg 51 ,Ici-r ct) ,111
(3) . •Th:d1MtlttcTh"1 \Lk 1c1 Wren af..4 giil 7.07 TR 019
7ircirt
12-(1) crA cr3era-Gr *1 Aro* 5ie ;177-47 *M1 zr3f 31/2 srft
*,erDrift gia zr4 * \I *rtrift 4.Tarra
(2) ;it tetiWt tfirrfOzred t-1 ‘314)cZçcji T 14ei 11/2 gor
cr,,tr 391:ftft temr 3:1717 TT iiITTIFfaR ct)01.
(3) VM Cr;e4 rts-f Ctri a 14 ra M wi'IRIcitiiiiRd & 9réi747 IR
RIPT iichcll
13-0) ctri4e6.0431 IWZPVE 1-1 NF th9 4 T "17 tit tea 34 If cg
7r4711 fdtd Th`t u177 I
clogrei lYci tAci<1 TT Tilpf cl,idtietcl 311-3 terfrit 7.fITT41 6 Air 3th
xa sumo* 1.441. tfikEigTM 0)77TT 013 TT 77faT 6)4 0 ath fazafacucia *m-1-4
*-d-r* tz3 tipiitzt zrzi-aarur 303 fAzMur ,4Sirr 717 faTafac11c14 ‘9111-cf 1014thiPen. T
ftAswa crIzrai cA•ii
441.a With. T1 71.4 g'-ci TR-at cN-IT 311-477IT g)
UI 7R1fr3 k1 Zn 314R fazafatuder * f matpa. t.sr wgft311
yfer -*T crair *3. \mom t att3 gile1/2 T1 mu wrzfart 31/2 vif0*-rt
3T-a-rm t-gram:
cr3-rg zr6 14--aft..ficia tet wrzt3. ft-31) crart-rt aar
4Ri 3tIZTRT 3111.9 clAcicia gRT 11)) TR.51.6) afftg. g), 113 3TRITR 001 r$
Ara* * 3t3pa 14,a alp1/2 * kr* Tut * ctriatiRr *-1 p1/2 *R1-aTtr *
wa-cirftrzfa tejyki gNr tza ol4q161 *1 aft m-3 tor t
vikffn*-3 \moor t aa acid atm t
ctrita STR zir4044) 15I ITT1T $17 311 T.T *RN I
thll Rftd ca”.0. 7R1 I
14-(i) git cgc,041Rr 7Sr ftZPVI cgc-I4 crnd zrPr44- arT31-<7 31/2 *I wit T.,--d-trfa
711117)111 afrg3 tit 4I1404-1)jrcRI)11 <001. aM T-4-d11 TT titHq-f c001 uhif
falII itzrr 7114
(2) 310WRE T 3141)9. mr4i1 crt qpqR 37-4R1 * alzr4 *-4-4 *
A-4-0 -**RI ariz *kat wr 1=44-ri
. (3) crth cipqra, ala 30 74 cl2c14 ci gRT 70L'11 WM, it7 T
WO-011 T 1:144707 11/2 ,t3eitar mat a6No1 cr, qf

Ema
EwkEEmWamermwawg.
mgraamfigfifiggwfiggfia,
.Efiafifififisgwfia
wfimgafifiggfifigwfizw VEANV
:mfigmflfl
EEEEEfié Ehfigfifiwgfi‘éefls
fi¢E§w§EEE§%E§3é
_Es&£a§
EEEEEwfifiEEEEEE:
figmwwfimfimgmnpmmau
fismggemfifisEEEEEkfimfig
wfifiwfifigfigwgéwgfiagwgg
Méggfifiawgfififififirfinwgfi
Eggs EE.E¢E%EE&§E“:
”EEmE
figggfisfiwfifiwgfifimggfiafifiw
EEEEEwEfiEéESEEEwfi
fimggfifisgrggréfigaie .
, Efigfigae
wEEwEEVfiEEWfiEfiEEEE
Ewggéémgfiggggfiawg
£0 Egéagmgwmufifigggs
Erfifiafiwefi
fiwgfifiwfirfifigfiwfigfiépfimefi
.mEVfiEE,
EEEEEEEEEE:
_Emfigfifimfigfimfi¢£§fibfimgfl
Eggrmwawfiewgfigflfiaggs
éfisfiéfigwfiwfiaémw
wEwEEfififigfifiéflsgsé
.mélfiw ‘
EEEEEEEfiwfiEEEC
_EEEN§E
Egyfisfimgfigawfififibgggc .
a _E%EE
figfifigfifigfiggwfinvu:
:EE
ngEEEEEEEg
“58E Eu. EE m5 AM
28 Eu VN ME. EVE E9
(if;
(c;
‘m"?
39 3tht 31311RTIT TIT0W- 24 vIzt 2015
(4) wvf 3-0-4t 9-97Tti1 MT HI-Jail 110-d W@TT
frd-,11 alAsuftn
T3TRI I
15-- icr)/tri--rz•I MpTr 441 t-10 t
MIT tkiT
ver/T 31TR qez11 i t4t4I4-1 ct>01. 14 %%i tsi uflo
16-0) 42,c4-St fkgrer trf t
-itr11171i c.61 wzr
crIca tthA wroi A-41 fff 1-
zc1vici4 3t7 arq-A-4-1 cr),
6torai7 mi aifr-A7t 3aPCITITPTa co4
317z[ 7111-1
4 ;rem ct,nI attR t(-) 3TRTSTRA 5T 1L(14-r
ct)4i1 lur iti%i 'tau
rgcsi afRT OI44Rt14 a1 fatityRtic MT IzIt9. 117 ,(-15ta
t-MA 04111
17-Wa twraTuRi 4 fer41 ftt 4
ApirA aft/ A-6 vifiAAA't
Witri cbIf 31)-1 McTrzht tiLlICs-1 ct) 111 at-I1 faftn-
f'srr writ
ssiam 18-4-Errarai Th-z-sf*
-(T41 11*0- t w-4711 3t17
co 1 3.TtR t{) STJ-ZIT 15T tik4i•-
1 cb1U1WIT faita 1:27-11 \Jilt( I
ad-Mmt 1G--
(1) Rcd 34RITMI Mct Nffo t wkiii 3117 -tr
vifT0
ml Iraq 45 111 3frg ti4 M71) M1 tiLlIcyr c4) .4 0.
61\ti1 'NmP- ffiTIT ‘3114
(2) itt?f3Tf0-4,-rt f4-ffi blirr
3174.1 3T(01"41 20--T5N MF41171
tItaiT Pe3t17 Nal TM-TIMM 7-frP
RS( 3Tt Sr1-34 fkzPit1I ift
W4: 127-1 tR 1TA fat-d
f -trr
foaftnd 21—firaar611 P4-11k2w
viRwitr *-
gr-FE) amtr () iNt;
(R3) cr) I 4 4;
(Tr) fam ANA;
(Er) 1'4 Trfilit;
ftiluirr A-1-4
(A Tt4A A -g;
(E5)
trtmir ti
3TR:I m-rtimr-tt trff4Thzp-il glI aft-ad
P0-411.
Rro War •Wit
22-(1) P1T flT43-9 3fr
AT4t fdtit-t-t •
7rai
(2) a311414Ars wq-A-411$ 314-9 •<
3911T 1-M-1 d - Tr4cTRII aft
t4, 3124h,
(M) f4S S) <4040 Aftirn 3417 440 --Tr TilTz1-\4 4171 1
:R 1941em
m-R91 3417 ffiI t 4)14quile?f,
‘3 -̂1 41'f 3N fare S ffç 3TT-2FRIT
MT VITcl- a•-0;
(-a) ffi-,S a ittr8 3 a A
- 11: 3117 zi7
tizcitert ft,41-8 ia7 W-417 3117 ti<r)(.4 trifffi
4T1.-11;
(10 wiT4 .ER-irit41 fq f1i1z ftir
AFT -ip-A-4.1 A
,m;FifOtr% TrAcM arcr;
--0 3.1R4 A-Tr 4, 1-
411 fai:81:4711 7RI
Sit N.P1-111n.., I V id. ) I
S

.
‘ m ‘ Qflfiflgnzsamkgmflnoa .
r 3 midi fiafifiaflflmflflfifizgwfigfifig $3
fig: /
a-.3‘~§m\n3¢§Emmmflwgflgmfififljgwma m3 .\
égfiafififimfiagégm%gfl_
b alcvfimlflammwwflaflgfiafimwflafigammyjflg
fivfiflgifiafigwfigflflagzflafl W
mflmfifimflfifiwflAifigfiaAfiflwfifig
fi§fi3%fifigfi§%9fl%fl§%_
vafifiagfi§§fiflnfi%fififlamg.
filimfigflmfiwmamgaaflfiagmwAfigsi
figgaAaflfiafiflfimfiflafiwmmgag .
Amlfiflfimfiwflggflflfimyaaaafifigiwflafififi
afiqwfigifigflgfizafiwmmgfiflfl.
Eflaqfia $.3Eflwfiififlmmmgflflflm3flgejfigmfi
H29:"myvawflwflwflififlnflugwfllwwumgg.
E was magi Em £33 94 an”. gym mg:
2a «@943 8:5 mamas $ gag £4; 33% «#4 mg 3%? «4W;
Egafigfifiafigqfifimggmfi“wflfimfingflwm
333:5
Emagad mm Blammaflflu my 3% 5% my?!
nfififi Ammvflzr ‘
fimvmwaflufifl
33%.. W
Aflvflflflya... m
Aflvgflflfl“ Ht,
332% m
Agvnfiflflnfiah . M»
fivgfififla.% m
E g “a £33 3 a: ma afiafifl a 233 m
gadyéas M
333.43 mm 4% a? “may 431/5me 33? g E5 9% maxim
mama:
A~vwm§w3§$dfl$$a§1flmfl§mflflflflfimflafim§
%%.QEET
E 9mg my magma?» a? a: fi dfiflfi fl figs
fia§mfiw§§§mfi€§$aafl§§mfia$fia§
Amvmflfimaafimfiamflufiuflmaaefifiafl
iggflaflzfifiwfiflyflnfifl“
9.Vflflfifiimw§3w&gflaflw§mwflaflm “
“$332133 . n
Amvggflflfiflsfiyfifigmwmyéflf .
gfim
2&2
_
4::
E... in: 3:... _ <59...“
ti sthT 3.7111TR91 quid, 24 7, 2015 9
23-(1) q,id E43IR fci1kuni tIA1133( tul'td fkm-T0 6 I cpt <
4T41tibr-c tirt:Pi *tetc6 39-63:01 13-414-0 3th WiT4 VItamti 311R
‘11 IS W4 itfl
‘3cc1 Vki dt1 jd TM tI44R4 Thl 716-RI WM111
24-(1) REM 7131ER fareat-ergtt ThT ATI( /WPM 1lTh70 614II aft f4Thwif Thor crftER
3itR 3TE21thil
it it aitt-q •6(.1/2 ER factiatlicttu Thcl teTf5 trail it 33191-4
rritkrut trmt-ct•3 4-3711 ail-R .iticitt ct)4ft
(2) ffitrt rit3ER 15T tiott Titt4 TR:ful ii -caft 3t1/23 u33-41 tfax-ml 42co
1-A 7.171 a ?aft f4n4r \AN I
25-(1) fact( wRift, f4-Azt Trpral Itemm cot<-1 it fc itrafturr134 iM Mrrr
vg19 f14-rir a•ii
(2) racci IA1? 3t13 qc4tir1 ell- tat MT ThIZIT ut im
26-0) qult.4-1 4.)4 RYcatilciCi Th-T Wpi Mthvi-1 itt-RI 61911 61t ITU ffictlut
31e4tqff ot1/2 •if m 31-CRITE191 311R titiT .6619c1t ItrulTth faYafactictRI 3156T9 3-TraiT ITT
3TR1 TRAIT eweit 33941 imtLw 411
(2) Thahriti w1,4 4-1 nor( ,itet,t'i 33-c3z11 twcictD 31t? 31RI 31 di at3
ctit-44 kitIT f6f8U NAN I .
27-i14,14 1439-6. 14VI iRR ten Trittffl a113 t31/2 mfOnt 4,
qki;? RI fttz-4Z1laziit f[I1!1P1 Ettfk6 %01 owL rdi Yifaxua 31t( n3-1 tA
gl-t1 134 1%ft f4-4 vliq
28-0) nit rrftzre aarriwttit mitrlyt- q)RlIrt8f crt it rs
trp.mi 4-11 eft
(2) iff 3alliTEM 31:Fe.T1 3111.9 t<6 gR zIT
ft-R11 166-11 Met wa3ert 4-3 ticrta tg. aieTft-
(4) ffi 1kjrrz it trarnftzti 174-r 111141t-ii+14 1:R TI-01 faktr nq,
43 3T39 t39 fetelf 3117
(R3I) \ictcf 1444Riti it 34-i4t rm. fkgroa3W Pituctr, 3T-4-fct1/2
itt RI-4114"i We 1/4.71191. AR. ciffirnftdf 31/2 tfttiRicf 3TR4 1141tli 4641e1
fat; -01:1-41T Ort-11 31T6TAV
(ii) f3cifacticie4 33ftrneptftittftstftft TWRit 343 4-4-d3 3W3 tu9-41
rifte-RT4i;
(11) thracticitt 4 3Tann 3117 31-41 /16Tfal- 311R IMRE 9, co tui tt
f?rpg 3it3 ‘3,1,41 rift-at;
(u) fqaftratt 331 4-r4va aitzrrrn 3h 3176 tifiq, Cr4
ITYTRaw ntut att cr4 rd324,1-71-m f= d/rm *A S'T
awar it ft'•fe Thrvf;
(q) qflittit 41 tar VM Wfit 31/2-afthm4 nIff, 4140 *17
211'4130Pclk ii3p-riftt 41 3117 31-grt-33-93-otw 484011h 31/2 33Rrikro wzr-a-44
tv; •
(u) ntwritzt (It 41 01 ziff S Th74
246 ItPil On Via-2011
ittwrzt
Ttfiffit
tr&tir wftrft
ftraur-dzi
3r.1
St
qt3ffiztrril jet
fitit 4
vein

wW'wwwmmmgémgeW@
g
g
g
£9ng wmwwtsmbuwfimm gmaemmn)
fmw'
MWWWWWL¢W$WM
fgmmmmnmmgm.
MMMWEWEWWMMM&v
,M'Mwwfiuuenmmazewmmmm)
fnfiewwwma
'mglmghguzhm-MMWWQARBJWM
—2mm'gw&mm@mguwg
mwwwfiwW$wfi$Wfi@ \
WM Iumngwm
& mahbfllWfiEMMQIWEEAwmm—az 4
mega
mug; V 5'
wxgfi Inflawwg MSW?
‘ww Mafiawwmmmww&mamm 141% «EL
gem wawmwwwmh‘wmhwm-u
' 'Imwwwwwmmk‘
wwwwzwmmahwmmmmawmw
'wlhfigewewme'
mmflwwmflmwmgmw.
i wanting Enamlmgmgmwnfinamngngwmwm—sz
,1 Immgagmwwwflwemmmwwwm \
'I’ . Iwmnmmn
: gw‘g‘é’ @WMéEMWEEMRM'WEQW’SZ '
‘1 Immwwufiw
\ @wwmwwgwwmwwww _
Iwwmwwmwmm 'I
ma$mwgwmmwfiwwgmawmw
awning; muggy] upmmgwgfifihawawgzwhlmm—W
IuLgi. maawawmwfiaw.alm maMBAME)
[ma wwww 3b
najzzuemmwzuemmwmmwlwwm '
autumn twmgmmafinwmmwwm—sz
6 SLOZ Era vz “am magnum mgr: m
war.
10
t3iW At7T 3171TETN°1 TIVE, 24 T. 2015
(31) 7117Pit T EYNI afrfortaztratt Aar fat-
4 • 44,A 4 vitt; et -1
therdA t ftA aart-rt tar sTAt-
01 t tzaTZ 5 ft6-4
7-11771 'Z11 tflq 771 444 iztP41
31ta 777 71 gittr;
wrIA-4c21 taitatzt) wtrA
47rFil;
(z) zwItt, fttatril, 3T17 3T71 ittfl
faRtfizzil
4 WIWI ART;
(z) 34i)uartl, test3f -
al. ikrifffitri. izrz4 atIR iritR) .
R3Na 7771;
(3) 365M1 7SZ1 31711717 71 74ft 77g7;
(a) fAtit, 7--
&1 3t7 3T71 tart to-A3A/Aw1iaR1TdzIl 3z-lt
72/F9T 777-
3t7 3771 rnr4zr t-im;
(140 fatairdA vOrt-rtkeE
3actiftAl A fki'6'a editiAt
sPzmitA;
att7 •
(a) R444.4
t aerA fairtz ftA trA ter ITT it
ZW 14,4) urt
7t-tA t
(3) trd tem favairatt ftA crrRitrt 4.
tzt14zt Tra7 ;tted tzA
cu ft4 trf3fAti 4 7 'd1
taATA-411 -ff ftv-i4r4
m tA
tA tittr1 tiTrreda trftt-dA
tra A altrt
tt--A
&am Ititt 3iti
wR t-aa 4 -41-41 fet 74
-4 TR till Af341-4 rstr-c
(a) 40401 39111713T1 A 3!--14tz ft4
-ge A ,t-tarRea 3a.z gHt
't17 fakll ajltfll
fAfA-Ktz fit.441 qr44
wrt#T A crfklyi A izrow-1 t-et
ffle ftrofAv[F-44
ffat Etc-11 t4 3114z -
411 441/1 tregto 1'471 4
Rritt 344ra
ftat traftAz t-ztA A 3T
-frAt4 rot TFIRrErro A
tirdcrem Trc Thtt
ttzttN-a t-
RA A acrAl 3Teittl 7 fAtEt A a WA
-A-4) 4-e511 trfat tr4
t-RA ws-Ard tatz-170 ‘Ata
zte4a
S NAT t \it
74711itTI 7T7W t 1
Nalits1 V&A
3Titt7trl 3i1R SI 7 3770 7 3147 TO
t;c3. alunazt trd
Trro Aiforz q--41-2)
TAW, ftwA fAttaftra WWI
-z-AA t
qni
(q
tw iuTrtA, 3rAta :-
S A ITT-1 tcrAt 3117 - t-ft
-FA A w9-4 wr4A-t43;
foaftargu 4 Till) tattrtil, ft-
44Ar 31fiq crATu1-4:r
31E4117
1:114777 71 red f4nit arm,
(7) iteTuf arri Attar miAram;
(a)
il1. itterw. vrArtrt-t zwt tett fAittrths
-g--419 7771 3i)7
3771 31tei Thuifta tt-R-A1 3t1
crz-FT ft-A tar.) 3A-R 'cum
vittT
4) ft4) 4.tA ta-Atzt;
(z) fOttentli A Ziagri Aro:ms)8A311, it4),
thuctill 3117
1111P1-144 5 ftlR 117/1
7_ff mlfAtitTot;
(10 34tki
11VIirt
treTh 311-
1177 777 71 WA;
(30) crt3113t 71 7t7R7
31771 tr4lo 1A-44, 1AEW‘t
317171174 tIVECRI ?keel
trf 3fR t--v?
g;
(t) 1=4-4-ttzirta-A z4-r) Et) ftEtni
tA;
24t, KPH Data I Vid.2015

“oz-11m l "“(1 Max “11:
$911 1:1 19119 3 1121113 12 11111111921121 (12)
igunwwwwwfigwwwmw
‘ LL19 122121131 131.35 1121151 1519-11: «3315 99.1129 19: 112112191 (13)
€215 L911 Lei—‘9 H2“
1119534125 1315131193 1395313113315: (1.1.)
“.119.an 132 9123. 1111111 D15 g2 1311-1111111:
‘1‘: >119 11119.15 ma; 1121121311 @ 111961232111 91112319 11 1112112151215 (:3)
5121139 1:113 1:11“ 13%} k1
;1 nmmgggwmewpugmgmmemmwfi 1%?!
1 1112 11%: 91211 11125152; 53151215, 139 1211—1111115 111112125 hum: (13)
5mm 1% 151L311 HF 1111318 (h)
Hum M 1291119 1111 W411
mmmzawmwmmubewuemww
1 fwmwgmfiiwme—nmwwmwm
1“ ammuaahtmmmm
1 mgmwawmmwgw'wmmw 13119
‘ 111-112 1:31:31“: 921 911,111 :1 11ma 31111291911 1111: 11119111119 11i—ei WWW
- 1g19919m91511m
1 1% 192111129111 11111 13—1211
\irk At71 317fTSTRITT mild, 24 ‘7, 2015 11
taimffil ffi Thwa, 3rgrmr4 3ft warrmi ffi ffig am-41 iiar-4t
fa& 2Ta-mr4 ti aifiv ‘3.iffi fc fdxafaimeig waTia fW
31aR17 tiiciacb,4 ?arta q,'-ir,
t-A t1tnP4t 1=14-ffi 1=.7 Nvi A ztram àfA9-
0 *Alffi fAtiffaa 3t1T tritafkrai;
(2) WI -e00,T1Z1T9 1. 31-- 4A-4171 3Taf147, th-DP2q fAft-ca
mulnwra-rail afrz arRi idift ffit 7€47171;
(a) 3F-qiIevr&4f aiiR crif4wv41. frS 31--Arm fmga Thaini NIT
TtEr 4 t, Tim Trt-MA hTromThcir ffil 'fa;
(z) f1t 31RI PicimufAdtaff.iiciZI Steifbr acirf A TFR
aiciwp ITTA titcirlf aftv 41.04, ,
.(2) littef4, al:0144 31- : atiT TurTuilzr-ffif ft-4
a-0. 443,Aft-ffi;
.(14) 3TUTITIMI 311-Z 31R:f /WITT t4ia cif Thbf 4-#1 3TR:I
ThaFc-14 vr4 Affkaril gkr fro 7 t
30-(1) Iawctu Thci mfOw ifiiit 014 qft ffi MyrS aitft4 ffit
51g1.41 azii tA ft41-ffi It wrma WTI itt TN?? %WI 71011. vita fatta
fArar ffirAm 3AT P1 3TW iIt taw 4 ft4i8 tR e4-R ffitzfli
(2) TPA. aitr41 %ant ffi Tim ta 4)14 er, a-04w ME ffiTerfthiiii ffir
crwja
31-0) f4ratri-Fii m afrgel c cii4 14131g Sftattn ffi
&EN AAR fa“i ffirThl 3AT 59iJj TFAIthit l<sid .c4dlcfljnc S 34T41 3tYR 31E
wri iaif 4 co4 Enr. Art ffi zifOffi ti M1, wuzli
wet I
(2) wrillaff Rite ffi UZI zff S i9 iffi 4,14 •af3ira Affur Tifta 4,18
atiR 'ffiffiOtifii 0 lv,r1-471)
. (3) w,ffintiftt Wft LW trnaTi WM 3N chid ITRER
ciltif W4-71 3N Old 1:fft147 gkf TilZei)cfri foa ritTS -Liztuvr
c.t)) Taaftirt L.R7m ffi-Mtlt aftv a 911Ø &IA 4 , (t, uliattr
32-(1) rereatrati ;IT* t4tipl f3f4-441 ffi ffi &law f4saa wiartial
%la .04m/014 ER eimz.n au'
(2) faci1at4ciii itec•Th fkgaa fffi-01 t4tir ffi rita arffi
es--41 Ita-r4 qp4fZi ffil MI& -14,4r ffirArtr. fkkvi ffi R-rfffi Wivr Tut
wermItiI5I 31-43R IRFT crkAS 4Yt1ld Itaqr< Th-T f:Si:47W1
(3). wf4a- cwicua S .arram ftffi- T-arft aftliffi ffiR
Trffiat t
(4) 3W41* W4 t. 3TTETR ch TIT 3TTWItW 311t1R IR
fkRi) wriat ffi Tnam -4 fW-41 fama ffil Trait 30 \31-10 facAsvii .watrft
glt ittIf Zdiff I •
(5) ,ffi;ffi-LA ffi zirew m-10-a cr) Ortff ffil 31111a Th7 f
t A-4 ffiltffi A cr2ciffWa ffii fai=429-o straii elm AR ffi;d-rfAat iu Mftzvzi RA
TrZ) MITA tfr 31W7c4 Tht4 ZIR WA mialeizi A Tifflia 9 ftw 6141
33--(1). ft-41 atm 5 fkg cr-,1 um al ffiraRil fffitRot 917. 7-1241 ffk ftt1T
11RICC,11TT (414 al titan f)q•-*,t, ffi 3Tft71 111 ticbccf I1 1AT-oft-cif-ail ti
711i11459 VI 311 firm Trai afrR fffiTT-0 toi a S ffi fcit7 ftraft-efiffi-ii
a Ritz
z111445 *7311
aita wet zbi
3aTh-R
- -
Oatn. I Vid..2015

1.1123111»:
L42 1:142 121m
@1121:
1111mm
ma sewn
21141111
11
natwéaweapnmeschwwmwmmm111121111111.
gamnagmémmmmauegemmguaghmmmgfiggh
1mg; gmgmm1ma1g11pmzemmggeha1¢ IIRQLMM) .
Iwmghm1wutwmw1mmfmuw
wmgmwwwwmwwwfl1mwg
maeamgnghweiegmmammmmmmgghfiw 1_
\ Wall—Wm:
meawwan§wmaew1M$mem$
wmwmwmmhbmmgmwm
lam
uew1ea1nwmea m~$wwwm,_<c)
IMMQQPJEEW$MWMEQWML
$%%a%%$%111m'mmmm%agzs1aa%%%mmw
wmm$wwwmammmwmma
tummznm/mmalmg
111111211M11mewmw1m
'UWWfiWMBWMLfiQMEBW 115%le
mwmgwwwmwmeM1M 1.
11%ghwb1wufi1emwwhh1aewnmwwmeu‘
,Iu..¢ua1gnai‘ange @nmfi‘w
MESH 11121111211111 12%th 11115112311111 mummy 1121111112)
I
gum: wggmwgpwmgeamJ-hpa'zlbmhgagwggnmwy:
wwW$mmwmwwwwawm1m
wmaazmthQEthmmwzmmgm—w
' Imam
aWwwewwmsawwmm
- Iwmmm1mwewmwmm
mm‘mmmwmmwmemebwmuw
wwwwm$wmawwwwmam
Iakmmwmw‘wm
mmmmwmww1smwmmm .
fwulhkaw
12% M121%11n% 1119 112121111 we '1%11Lite '1%111\ (2), '
$m1mwa1i$wwmmmww®
fwwwwzuemmmga'aucm
wriwuéqwm mm 1119 wmmwmm)
' ‘menwamwww
21111121 MWWW 1212an 1%12mram2)
- wwwmgeww
waémwm1wunm$m 12111121111111)
fmagggegmngmm
mmwmgmmgmgwmwgwmmmmm
wwww$mwmmw12m®
9102 Eh va/aau W 11;}: LEE
71:» “(.7 1.7.74.1:— 4.1;;
RPH flhIL IVjd-tlili
36-17T 3Tfill-TRI11 1154d, 24 2015 17
ifflfi att7
efrrN
gitwftu'l 3413
fel45Rif
i1ft2 14-irc
1-Tqi
TRI7161 Thrl
317R1
'ftrufe-ard-n
31f4-thlrEM
arRisp4rPrd
9-1W4e;41 aT`N
amitsft m-r
SIM-1717
R-ur-fr
f4lt
€191-4 '1*-)
mar Ertrurat 4 RP:41'6T 51 t TM) ET). 311[9 61 r an-s4 4-1- 4R)
a<pck-r mar crit mc1 Rnr f4-4tt Rrr -f6f0m iT)ur 4 4-2P Thift,
e iiq,iRIf irr Rpirfrad- inth fiaftz-q4 m-sr 4-6-et t f64 <t),6L4ft- cpi
3011-6- acnor t
(2) cp,q1411.1 6 pa ftTZIT Jiiir 31ff9 6 111
34-fraftriall 31-4A 04T4iReil ;13 fk tit tit taP4-01 -srat
349 , *a 4,14 *94 gigr 31-4e .07ft qY15-1 ZIT chc-14T17FtTa1 71)-TTIT 7T1 znuff*
110-1 ctnT TM-cif t, Rt--6-9-r3t- mat au Th7 .elch311 t, ulTr cr,id zrfai-4
g-1-71 fkNhi fawr ..114 1
35-,* e4T-TT ch)g -3149 37,11-9 6) it tin unT fty4favir44- ft-itr
crarm-rt Zn 3177) fki5izj ttit iro-rjwq, wzr 4tfirn- Zn er firr nth t
4t .3.6451 iT 51.1 t \i1 •unc1 45 T,1141:11% fWce: ft-41-
itracbr ‘3i1 -ratio A 1. flRiv.4 aift4 tlirr
36-‘451 ffitratIlc14 r+741 III 451 ch 31-1419117TznzIRPTZPII
349 ,t-P1411'4-ziwr Th't vre4T tiiflt 3 TT
13R4-rir, iwRir zrnmit eqi-a 31-R:r urr4?[, it* miftwrtim=wig?
4uffiviL 011
37--facnencd4 wrfnilt ZIT 31-R4 flTh7-7/ 31-6T+ZI) (ult9 TE6.1-11.
1:14 PZ1711 ite4W1) m-sr anu 41- TRr ftikit w•R Ttizr‘r fu'r•i
Reim It4Tr gq ftg-gyrif 1cl irr a5e411:1cr th5IlT 1-1 ftgaT
31* Thr) *SI 3T-d-M Au- 4Ri -ril-Trr I
38--Itsarr-Fir FITTh-Tat ZIT 3Tqf fifTTZI m45.1 cpi4ciil
ui* RTT1 4 It-ift ft-4T irr faiiirl It 144,11.-mr 4i1.4 45N14 31Itft9FIT 91,9
zPir
39- envidir ft-Rt 70-m-rt zit mat Wit 7-01-4, 341TaT6-9,
chi irr 3T94 6*c1iaul, 3fIfci1411(9-4 31T1KIT-74 A -A i5 ZTI ctica
mi spiffuro itZn giAr i th t{t nch11. 341-Tat4T, 9.31-4qT61, Zfl-
cT-t-IIaks1 4 -Oa t1 IfQ,151i3C111 ZITO W14 4 14614 rOTTIT
5711-4711 aii4 3i-fitter f4trir 30 0446kM .T.1a514 W3I 4 -1/619 thRTT WZ)711
40---(1) -1-.F1 &WIWI q:). 349 TTRIT 7RIT 1Tt ReHim Z11 31allV -16-NT
tcr B4-6--ea m-uur -t-r-4-Trr
(2) TO 3arH-1114 310t9 Rif uffa1/9 ZIT 3Tallt3T TETT
31TRTWitt kr t1r4 7T4 1T1 z121121TA VrdcvI it-tr t-r4-1rr I
41-(1) T4Y11-atIld1.1 f414 arritri MTTcNl Ett b-Clt Thr 314) - -2-1-111)
far 7-2-TifeM coiAir 30 Rprir *1'2 chK Thni I $€ 1* Thai '1,C4
zRR-rit t ER 34-5-13T -161 ft7LIT .7r-iltrr I
f4.44-1Thur-6-4 RP-Trzt It--44-0 fI1 1I IRt t tRflt-p-
It-at coi.1 tar tfaT
fai rthou ipi-wir !tit t Zn .114-T1T+1 .1=411 t C T91ft .7Q-T4 th;7-fRi
cni cpcir t
119.RT (1) A fafliard z/9-aft 31frc5 319TCP1 thra-avat
t fa-4 f4-k-4faskiel gri-r tut itRuT -11r -0 f•Ichi(41 iT 'Ri-,1,41r 1
42-(1) 1r4$11EIT5TTZT imir•zr fTM 4t 3.-P-1WI9T cbIfl lrw ft-ritMti-d tNiti
‘7Trr mar tlirrt, apaia--
(t) -T41 7-f- 1 a faRcrfacpcdu mcPrifizt ftt- ;
1 0,5

wk»,- , I" 7
, tn: .3 ,3,
a“
4a.»?flatw
: ft, Maw: ’
wwhakawwwkmfigem
, ' ,- .» $19”W1?*=V—
“HEEEE Em Eng ”Egafig
ifiam €15 an E5
m w 5:5 5% E FE E5 g NE HE; E 31%
_£§EE®@£EWEEEELRQEWE§$
Ema E wfifimfiflw flEum wEmFWEflflwE E253
.mfiwwvfiwflgfifla
ESE EVW&_EE®@£EE¢QEEE&3
Epfimflwrfiwmmgfl
.Efirfimflflgggfiwfiaflififlfigfigg
.mfiwfififiwégwfifig
Pfigfifiawafisfifiggfigggafi
figfivfifipwfimgggfimgflflwmmmgm 3|:
_EEE€E§%EEEE§
Efifiuflsfififigfiflugfifiwrfiafigfifi
_EEEEEWWE
Efiwfiaafi Ema”? BEERlErmrfim figflmfi 33:2
:_A:55&EKE%EE%E%EMEEE%6E
5&_E¢EWEEEEEG%Q§_MESEVE?”
5 En 653$ fits .va FEE E? g E m E: E 55:3 EM
EMEED ewfifiaicgfiflumflfiflfifiwfiwgfigfimfiw
.Efigvffiafigwagagwfifigfié
ELM
@Eggwggfifimflcfifigmfifiwfig
Efififimfifiggfiégfigfllg
_EEo%wwwfiwv£fi@§wwfiaggfiamsfifiw
sEEEEEEEEEEEEsEEMUMEE
patefifiwwwwbrwfiwfipfififimflagfigtafimwwffi
@fifikwEEfiEfifigEEfiEfiEflts
Ermfiwwmflba
Egpfiwzwgfiwfifififififiwfiggggwfia
fiEuEEEEEEWEEEIS
_EMEEE%¢EE_EW_§5
EflwmflfimfiuatmmmfiEfifimzfimgwfigwggfi
Tgfifimwmflfimfiwggénfiwfigfiwgfimfifififla
pvé % ”WEE EB mam 5w & rm Him is MEN Ea awamm
_E._E:EEEM
EaaE_ngKm§%§wfifigg«Elfiwgwmrfi
@fiagSEEEEEgEEEEEEPmEFg
“Ewfiwwfiwgfiwuéfiwfifigfigggfiaig
_E£EE&EEEEEE
_MEE%
EEENEMNE fi§w&%EBE%
.ga.grgggfiggfififigfifiufig
”7y 5 Evin ”E Em rEo An 5: Eva £23 @% 55:15rtmfirwb fi
mam Ev «N NE: BEE», Eu» Ev
(.303). _ 5: :ax a?
0E WEE
Egg
FREE
5 Eng
go 35%.
mt.» "a. t. .u.
Emtznfis
Em Ebmg
WEE
5, T E
am E5
EEK?
Ema w E $
E: ”m EEE
Em fiagfi
E
g ease:
E
ttredrzwa
fdErui
TrkW 313iTt1Tr1 'quid. 24 3JJ. 2015 13
. (w) fs-Rit 31W4 01-T1 9-4) WRTI1T;
(9) -01:41Pr gt4 Wa 94 A-41 atru-419; at
(a)t-A1ai u:rer i flT krfa 4--ffr94 WrIfSA1 3T1 Thf0-
gt4 Thftg ft-TIT zruT -oti Th-film•ffst 9-4 A-41 *RN
(2) tntn-4 1414 A 41-Trt 4-91ftr tmvcrzUrr foaTh-ark-a .041 arradf apff
fq 1=4-4r 71.??Frr
43-0) ffiew çftTh-re fklb TaTTRa. ch 41 Th-rifkfto
4-9-4-ft vPir Thcl vr-4421 3TaT14:-
(s) Ths-1-0 !J 3ñ truit34 D)zu
(11)Parafttific9Q 4-zriymi ftie .W41 3R1 •it d MCI
St ,141 ARAT 49-911;
(9) 0-d 5N1 ft?) "'i1-4 041 3isT419;
(4) %--‘41 apzr u<Tf=44 zn ffrouzt gRr MIA fTh-it 301 NO
gpo Mft9 Run- 94T 0; ott ThfiTm Thrti A-4) att4T4T-9;
M f4-- T-A NO- vRT 941 *mid arm t
(2) faTh-TRT rat A ti<T4-flit4 9R 71:11 /1111 EFTRift. Th7 UtTzfrir fated-CAT-QM
fatitt fTh7-11- v1H1.11T I
44-t1171 41, 42 Sr4 43 311}119. T2ATfefff fAitth Th7 71111 t09Inti
TAIT 3ifq 3Taff .<0 fel-4144 3117 1--1-444 tut. w4-4-r 3171V7
VIRE I
457ffitigia VI 3.MT \LI'M'i 3121.01 •9y4 \t“or? WITfit-N1th9 fti01-zi
311R f4?:(711119 eTht1 3r-41 Ths-ra air 1161z1011<hi 3121Th Wit
+101Thif 4r4 Ottri
46-fe149 *nits s-rzfsul S - 1W4 4A-04 Ji dcli'lq Yr( 1t4zil
ariAT5_14T 1.4-fTT. VetTh Thrl tite4.11 -1:11" 3149. A ,?tgf u1I+)01 I
• 47A1) ft/eau-ea 312T0T farefF611 Witt warflt ZIT ThT
Mt, '011:1 fiiifWelleftf aT2Tvr fta---Azt - atk aTT-4 cbidomoU A
-01-4.4a ‘1491311 4r Ak-ol1 rep st 61.211 r4i TU-9 vlig I
'(2) TRThlW 1•Ift1 "q0. t•fl 3TRiftzTri 3124-41 14R1)491' Zfr 31allte
311-Q 3critfrf* 3TtftflT5i 3itirff faYciftl ti4 kra.
runstm 3T1474 i'it I
'48-(1) tift ft fhan331tT4libffkl-Fr-9 ftftztrfira 0,44 40 faRr
arTuR 31'T1. fattest 5T IT-t71ZI ch'401 '<kit! 11.20H 15B Wri
R<tftrd .41ft-0 ku-ri •
f4snti frf.0
(2) atii*,...(1) Thfli.tz
141?-4 ft-tirs'A :3117 wet cut,
'34:11T0 •aiwk ftaTui 10644sbia
"1-02.11 ij4-Arf,ft4 St -GIRT
49-(1) Fri:(413 t 34117
.ftrafturkzt 44IT-A4
f4sTA.T4Rt•ffs-ir ‘TztuT I
tre-ff ART )A- w 'fl tNet)H
MT-at-am-4 tWatitr4 fair 1.110442411 11 WM sr
zEr 9s7k fh-Qratnet4 uzutfrr S1 tilt
faraltarku sr a 409 q4 t3T410- <•4
4T4 ml cpfW-TTZ11 fw Pa( 4191-<5 ifiRt zu

4
‘l m rear WW“! 1m, 24 cm 2015
1 ,- ,(E)finfiamuhfimafimmmm;
“r (wmammwmmmm
~ (ayfirmmwfimmfiifimmfiIfiammfimfimfim
{1" mfimammawfifia-mnfiwfiml
f‘ (nmfiffirfimmwfirmmnfimfimfiwfimwfifi
- WWW:
43_(1)'%mmwmmmwmamwwm amm-
Wmafimfiwfiquia—
(afimmlwaima’ffimfiafimmmé;
(wfimffiwraufiffizfimaEmfifiiifimmmfififim
finfimfimfir;
(11) W m Rm”: in) M (#313171;
.
1
i
(u)%mmwfifimmjuzfirfimmuqa%fimfim
mfilfizwfimwfixwfifiafirfinfiwfimwfi?
(ejwmfiwmfiféfimfinfiwml
,, (2)mmfim-Wmmrfimmfimmw—fiwfiarfl
fifimzfifiqfifimm'm ' ‘ ’
-:‘44—m41,42qfi433§3mfi=rwrfiafifimafiwa§w may
wammmmfimmammaammmmmm WET“!
mmmm; " ' .
" aseffisafifimu vmmammwfiwmzfia Wslfi
qhfifiammwfinfimfimawfivmfiffiflflmwamfififi
mm$mmafiam ~ _ ,
'46—fiflfifiifififimfi'mflmfififlfifiwgfiwifi gan-
fiwfiymmfiwgfififimfiwmefiwfimml -
, ,;4zfi(1)fasafammwfi§afima§finfimmm3®maflua “ha“???
arrfw 31m 13> as Rafa-am?) mm 3mm f‘afifiu'sfiv mmfimfi'fi m?“
F‘ifim‘fimafiuraméuTmfiufiaafifiwfismwmmmafifim m?
:(2)imzmm ufé a1: mam? %3§ffifimamqfifiufiurmr€sfi
$Wfimafim§wémwm51$mfiwfiamafi®mm
"Wwaéfima’smwml '
“'48—(1)ufifiwfimmaqémafivfi7mzfififiufia ammm W
‘33mmmfifimmmwméafifimmfimfimfiw “(mm
mmmmma‘m- '
.(ZIBfiHfiTJ'oWfifi‘Emfimfimefisafiamfi
flamzs'fiwvasmmmammammmfimrm
'Wfifl-m-‘fiqummafiwfimafiwfiamzfimfim
49‘(1)§1fi'9d§®asfiqfiwfiammmfbawwmafima§w ma
”WEEffifimmmmfiwfifamfimm am
\
1;
V
. t
>
1'
l3
246 RPH Data I Vid-2015
I .1
14 La71- 3TRiTTR171 TTIR, 24 TV, 2015
5 NI
ib4fttiTF-ra
clNii
ethai
(2) TIT ‘3LIZTRI (1) -4 ThirW thy-0 UTNT taRT tigUI cRA -4;
iThi-41tvra-zr aitr 4,1 to ctro1* f&T-1 1I14RT -la a a i-NMR gpo
aro f tt1uei RTrnif-ffzil TT Ziffiain; TT Pi-t-IN11 aNcii TOT itt
50-- (1) ‘161 •ii•TO tra-R 17) ti-1 3I1lizT41 \3ti64 3Flen
cm tii4ET Qichizid t a Cl6 it'iTf1-07611 i1 ita/11cf Mnt
1-1Trr itraltarFtr afer69 ratit 9t thitr Aluz zth Art
TO Wl-Fri, own 6-thrq ft l'zcacric.rzr critter -# 9941
3TTNT (1) M 3147 t afet 1:17 11YORWirti4 MT ‘ick-N STIWr -111
IR R - 1-a:f tra711 mtliTZTT ffiremar-0-4 Th-ro A AP-ITITZTT
3TRIft17 .Jtrcitil Te-rcriE9 t3T 9Ijcl1 tutu TRH t thr t41 u1rT4 3Tlat
1=-0. 46 a Tilla
3-TZTTRT (2) a 31t9 utiti it vzf5T9 ,-1•<cf)K 3TrWirI9T
gN1 I ITItatt a TT fra-z1) 3n-ra-t varra-rt ra)
t antan ftzrovr rat911
-31-4TT7T (3) 31-1I9 3Tfl15T1 1I aalt '4 0
alitftiPTi 3401•T 310 cFri cp,“)• 3T1TTT ftftel Wit-41 'tftclf, 1908 a
3T1t9 fiwñ TITmr ftWIZt:, 1,)4 911- cr ffirMI ti4ut fo'6RuT ecrrA ftn-F
.41T1-517Z ZIlat at, 3T241:--
(a) fat) TTI8T1 z il41.4 Tiff' 34N ‘311R2id br‘T f --21 zno-T 4T9r 6417
711-T2T 4/1-1 c)11;
(tf) ftfIT 1*111‘if ektritri 3TT' Sfeiff 1-N,)cit ar:159 -M\FT- T;
(Tr) era-R:1r ra-Rriwr f+-zi) dlcr, an'd-ur tn. vn ranr TzErr
CEO WET2T-TT TTR TETI TPt 4,N1I-; aT17
(3') clU 31-41 irproir fIt itftu fra-m uncr
zrik ttr RtfrJ CITTt try IVO ' -Nct)H aT WITT1T Ulla fa.
thY1 31W4TIT MT ‘Icre-it4-1 faTT t a 46- f4c41-4nclz4 161 f."fh., t41 ffi
3IT17T4' lyTTR. 3117 nr aTf4f499 \3,440 t iIr 1-zir,gir9
31-trr6- t
Li arra fat ulicliti ffl-`4T vid AePIIclk eki $11'{ 1 3Tf4ftT7T
M rar ‘3mitm fra-zrr t ,<1,zr thdcw, fZqaet ara AT
t Rzcrfacriew zrt cokui 6-thrk Zieffff ari tat t f5 zrzil
t1(71i4 Mcf I18-1 Of c1iM4 l alltI I ratan-COT it \3471 ‘icc1-1 Mei TTR1 tr -
inc tNch-TR (4)1ZIB 91I1ETT9 t 1/431111 t it 9tI 3TilififTT it iTt#TI A24-q-i-Ecar
scctH ml ArTz-&-r cr-rth t th -6t itTlfTWI-621 31-1-4TT 3T7871 it TKei 3FTTITT
YIN1474 Tiic 4 crcTirtim artr+Fth gTR1 fatiTft77-1 1ITR-1 tibt) t
-014tRI (6) it 3Tt9 faTaTTetii T4-4--t itt 3T-41 RT-‘51A ,z•NchR
t-TRn 16;zrre {Ark zwnyzi f9f?( zn f6raim ft* in 99-thr9 fszrfaumzr ct
raiacric•INI mw-,4 ,crath9) it ftt cpir TrtA1, itTerften 6.?1 ffiRrzrr,
focil)?..neio alerWa- 7rzr rai crk.1 zr9n •ffa:r WMT
tkt aRt fr rT. r1Y4stiotritt iRci4i zur -Rtmosr cr) ticr.1411
(8) 317TTRT (6) a 31tt SITkM 3TTkRIT9T Thx ItTIT M* *1111' a
3.1-95 li,zn-trzFr 96t91
51- *Nati •04-14 zrz fared-triazi i15t t tRr f0-qqct, M,Isf
cb 'do& e aniAzrii icr4z.T1 tr 31-fin 9 cw 341tilla 3-NIT I •Qt
1=4-a-Tr tr 31-I9r-g9 Rcif6triercr fra-thr 9719r, .‘ar 9 4"t r7 rak
lt wra--th t 1 zifaviclzr qacr cri

,
W,
F
E
agfigfimfimgfigfi
WU, EEEEwE.EEEEEEEE£
”VZEVEREMWEEWEWfiEZmEfiEKEmfgmm
Efiggwflggfiwgflflgflggéwrwgglrm
.EfiwfiwEWEEEE
wEEwEEeggfiwfiEgEa
éfiwaEEEEEEfiEEEEEE
EKfiEEfimfiwvfigfigfififiéwEfi
Ea an Egg %_E% Ew FEE.“ E w EEK
aw wmfiflfifl FEE mm ea EE 5 ea E5; Ea Egg 653%
:55. WE EXAM Mn 52% am 3% ”w Ewfiflwfl E?» my“. @ 95%. E
_mfi&waE%Emg Eu FREE céfibruéh EEK
wfiéfifirgégafiflgfimgfiirgg
EMF; EN 3.3mm» Earn aw mflmis G :me mag 25% may
Kgfiwfimgfigfiefimwawémfimgfigrfigflfifl
rfimfimggzfizfifigggfigéfifiwfimw
EHEEEE%fiEg_EEfimEEEE$
Eagmfiggggmgmfifimfimgfimsaig
Effigfifiwpwggmwfifleafiéfigmngfi
ficrwfiwfifiw Emmfimggfimgéwggfl
éEfifiEEEmeNEEEEEfiEEflwE
.Egmflflgggwfifiv
Kb, NEWSWEEK «3.35 E
wififififififiswwfiwfigwgficfifi
WEEEh/mrfigmmggosgfifiufififiwfigfiv
NEWEEEWENE
€56. Bfiwfiflm «Egg 1% 5% Ewfirfim Fauna E A
AEEm .cfim WEE an ELLE?
THE E «Kw szmé .r 3,1.wa WEE 5% SEE Em NE avé fig
Wm 82 :ME. SHE 5% any E FEE mm #59 «a» £55 «9, Eat»
E. E £55 a E5 E5 E Ema 5% w 3 BE 3
_EEEEM~E5%EB%$E
wfiwummwggsfimfififiefifiggwgfigfigg
Egzégfifigfififimgfiéfiaéa
‘ _EE%EE
gmiggs Emmfimfi:§u€:5§§kmfifigmwgfifla
Klggurgfigfigfiéfifiggmbg
EEfiFEEE Egéwwrfirfisfievgmfi
E?» E: bucuvpfiasgwg my figs Eg¢w5,aawwflwmcf£u
ampafiafiawfiefiegrmmggfiamfizfiwwfiwgw
Eewfiwfiswfiéfifigfifiggfisé
EEyEErBEEEEEEErfiEflQEflE
EEEEEmfifigfiwEEEEEEEEN
"WEN ESE Eflfiwgséfia Ea KNEE; 95% an E
|||l||l|||ll||l|||llllllullin
mam Em «N NE: _EEE@EE Em
Ebfiwwamwrgan nWfiflmwflfiEEEfifiw.
m_o~.u_> _ Sun— :eE can
,Ewfifiw
EEKE
Egg
«NEEE
EEMV
FEE
WEBER?
EEHHE
EMEE
E
\ic-N stht 31711ZI1TII Trae, 24 Tip, 2015 15
52-31 PIW-11 ‘31LN zitcftga fraAl utr- 347 1t4e4-£11-dil Thtx9.f4nyv1nnmi
Nit A raftErr-dif A iiwfa Sit st jltriAir4l f4tw-fi ft4, rq B.1-4 IR
Thf0 zrr ,t4 arR:r NO- tiri-Act t 721T ffipffitheitt dITMptt 344-10u tiftfral/
7R1-111
wc-R,
53-(1) 1.•)tf it<OK tfT1 ffi-41 Tht6911 31171 •<I‘rt1 tit:PH ata7TO 7
faearall 3TffiedlITT, 1973 Wrect 3.1ffiffill11 3EFeal tist)4-114 31"tT tb--
A 7 ra4;r4 wzit-AATet fkhr t TrAil fra zaraf zqw4T r-41 rarara14 vfikr
A A- arta A fatte A Lino. AmlraTe, Al 1 3itiM '<6a totizb-R.
Tlfrat9 TH t W:1 ef 1:31-1 317011 TIT TI4'k1I9 tHIA writ 614:
fra aifONA ra 3TE(12H .04 trzqm till co
arifti Aftfnzi raRtiri
\i-vaRf 0.#, 3419 1-4,741 TRIT 311t1 MKilik 71Q.ntill
,(11/41-0 ffitTr9 41u.Sei c141TRAI* TPlaf .<tg I &PIT I
WERTRI (1) 3ffitff ffit it fbr 3TheTT wi ffirit 3T1tIR
31-RIf * ffii ch14 Thf69-14. a41 ‘3LNio fez t, ttiTir9
Aff eft imw ‘3-101 4r<11 areS Wei 211 I
3-caWi 3ft7 chkul
‘3=4 &r,1 A A Li 111 IA acjIrM cm4 3417 flA Troufitaf ITITFit-ff
ctr<• ‘Jvci ttulaccif cna 3TE21717 wf ufticruf ml-Ruro raw') 3ft7 "ffitd71.L1eW4
tt ftf-W4WI 12S-CIT t M58U M 111 teiiu 1,;veiYI R1*1-07, 8}nrnt 3ñ
el -tilt{ Min 1882 311Th9 *4zt-f *FITAltd t, MILIIffiThf At014-10 ffiMffiE:f1RZI
rIc4>16i<11-4.. fratilow. ‘ickv Ilt7T wra afurFF faxaRtilow Tztriem 3t17 firrl-Au fraw
urfra aTurrcrA 7m3Sr ati-f tIQoct UrNTiM Thra-Fr wq-wra-Al Trikwft,
afrz slier A 751 S Alum arrawrra clic-1mq aN Tiftwq RwA ttw tIcl/ I
cleVy( t0crii0 Rxciratlietu ‘icchf Ilt4T fb}.lt-ra, 2015 37RE.I1ffiii ffil.1T
t I
31-1gf
aii R,
SPF .RiRct
No. 645(2)/LXXIX-V-1-15-1(ka)13-2015
Dated Luclaww, June 24, 2015
IN pursuance of the provisions of clause (3) of Article 348 of the Constitution of India, the Governor is
pleaied to order the publication of the following English translation of the J.S. Vishwavidyalaya Shikhobad,
Firozabad, Uttar Pradesh Adhiniyam. 2015 (Uttar Pradesh Adhiniyam Sankhya 7 of 2015) as passed by the Uttar
Pradesh Legislature and assented to by the Governor on June 23, 2015
THE J.S. UNIVERSITY SHIKOHABAD, FIROZABAD, UTTAR PRADESH ACT, 2015
(U. P. Act no. 7 of 2015)
[As passed by the Uttar Pradesh Legislature]
AN ,
ACT
, to establish and incorporate a teaching University at Shikohabad in district
Firozabad of Uttar Pradesh sponsored by Shri Jagdish Jan Kalyan Educational Trust,
Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Must
Act, i882 and to provide for matters connected therewith or incidental thereto.
IT IS HEREBY enacted in the Sixty-sixth Year of the Republic of India as
follows
I, This Act may be called the J.S. University Shikohabad, Firozabad, Uttar
Pradesh Act,*:20 is.
Shop title

111111111131111211111111111241514015 v , '15
524W 11 m Emma 1111111 11178 21‘: 3121111 1121111111111 1151 $211711. WFI/‘Inflxgll
$fiafi1fifiwfiwfiwmmfiafiafisamfiuimfiwrmmmfim 1111111111
mfilfimafiémfifififfim‘é, mmgfimuzfiarffifigwfimfia “WWW
113111111 ‘ WWW
53—(1)WWWWWWIWIWJ§¥TWW mfiwrévfiqg
WWAQ73$€W11WHW1$WH1WW$WH Wafi
fiegwfizfinmmdusfiénémfiswamfimfimmmfikmfi
11111311111111W261m,fi1131§1fi=11%312fi11€11 111111131111121711‘
Wmmufimfisrmaswmmfim,mnmfifi2 211:.
musffissvamfiwfiwmzfimfifiadzfiqmfimnfié
31111111191137111 1111111111
(2) 111121111 (1) 1‘» 3121111 92111171111911.1113 311111 W 11111: 111111 2121111111
mfiw1m$a1=fimn1$ma1mmfimt
(3)mm(1)11amnfifinfifififimwfinfiwmfiwm
31111111111411‘31111211111111515‘25111113‘ Mmfififieafin’éfiw
afimawmgmafifiawfimt
WWW -
memeeafiammqmaawfiammfimmfiwmrwuma
Wamaamafimwmafiafiqmafimfifiamammwmfi
’gfiefiusfifisaufimnufifiwfiwmmmmw‘maew 131111111111 Wmmjfi
111—11111:me 1882111311h=11fii1§1$11 W" 111%, mmmfiowofisafimu
Warm. 1117111112111 W9W$Wfiwmfimwfiaafi1fivfififimm
,mmwmwmmmmmemmafim
'mmmfimmfiwfiwwmgfimmefimmt
11111131 1101110 11121111111111 11mm, W11. W $1131 111213111 2015 31:13am 115111
11111111
311111 11,
31m 1111,
513111 11111111
No 645(2)/LXXlX-V-l-- l5-1(ka)l3-20]5
' Dated LuL-lmaw. June 24, 2015
IN pursuance of the provisions ofclausc (3) of Article 348 of the Constitution of India. the Govemor is
pleased to order the publication of the following English translation of the 1.5. Visliwavidyalaya Sltikhobad,
Firouibad, Uttar Pradcsh Adhiniyam. 2015 (Uttar Pradesh Adhiniyam Sankliya 7 of 2015) as passed by the Uttar
Pradesh Legislature and assented to by the Governor on June 23 2015
THEJS.UNl\’lERSI'IYSI-llKOI-,1ABAD lfllROZABAD UTTAR PRADESH ACT 2015
(U. P. Actno. 7of2015)
[As passer! by the Uttar Pradesh Legislature]
AN
ACT ,
. to establish and incorporate a teaching University at Shikoltabad in district
F irozabad of Uttar Pradesh sponsored by Shri Jagdisli Jan Kalyan Educational Trust,
Shikolmbad-Ft‘rozabad a 'not for profit' Trust registered under the Indian Trust
Act,]882 fl’T’d to provide for matters connected therewith arlincidental theretoi
IT IS HEREBY enacted in the Sixty-sixth Year of the Republic of India as
follows:— ,
. i .
LThis Act may be called the 1.51 University Shikohabad. Firozabad- ”"2“ 5"°““”“
l’rad-esh Act,'320151
. •I
16 Mt1 31TIPTITIT -9-ME, 24‘1-9., 2015
Dclinitions 2.-In this Act, unless the context otherwise requires,-
"Academic Council" means the Academic Council of the University;
"Board" means the Board of Studies and the Planning Board, or any
other Board of the University;
"Chancellor", "Pro-Chancellor", " Vice-Chancellor" and "Pro-Vice-
Chancellor" means respectively the "Chancellor", the "Pro-Chancellor" the
"Vice-Chancellor" the "Pro-Vice-Chancellor" of the University;
"Court" means the Court of the University;
"Director/Principal" means the Head of an "Institution". a College,
Centre and School, or the person appointed for the purpose to act as such in his
absence:
"Department" means a Department of Studies and includes a Centre
of Studies and Research;
"Employee" means any person appointed by the University, and
includes a teacher or any other member of the staff of the University;
"Executive Council" means the Executive Council of the University;
"Existing College" means a college or an institution which imparts
professional education and is proposed to be merged, run and maintained by the
University;
(I) "Faculty" means a Faculty of the University;
(k) "Hostel- means Scholar/Students Hostel of the University;
(1) "Institution/College" means a college including existing college or an
Institution established or maintained by or associated to or constituent of the
University in accordance with this Act and the Statutes.
(m)"Prescribed" means prescribed by Statutes;
"Records and Publications" means the Records and Publications of
the University;
"Regulatory Body" means the statutory bodies established by the
Central Government from time to time such as University Grants Commission
and includes the All India Council for Technical Education, the Bar Council of
India. the Distance Education Council, thc Dental Council of India, the Indian
Nursing Council. the Medical Council of India, the National Council for
Teacher Education, Central Council for Indian Medicine, the Pharmacy Council
of India.
"Statutes" and "Ordinances" means respectively, the Statutes and the
Ordinances ofthe University for the time being in force;
"Student" means a student enrolled in the register of the University:
"Teacher of the University" means Professors, Associate Professors,
Assistant Professors, and such other persons as may be appointed for imparting
education instructions, or conducting research in the University and are
designated as Teachers by the Ordinances;
"Treasure?', "Registrar", "Deputy Registrar", "Finance Officer",
Controller of Examinations", "Librarian", or "Proctor" means respectively the -
Treasurer. the Registrar, the Deputy Registrar, the Finance Officer, the
Controller of Examinations, the Librarian or the Proctor of the University;
246 RN I Data 1 Vie-2015

16 am new 31mm m .24 Gift, 2015
Definilions 2. -ln this Act. unless the context otherwise requires.-
(a) “Academic Council“ means the Academic Council ofthc University;
(b) “Board" means the Board of Studies and the Flaming Board, or any
other Board of the University; ‘
(e) “Chancellor". “ProvChancellor”, “ Vice-Chancellor" and “l’ro~Vice-
Chancellor" means respectively the “Chancellor", the “Pro-Chancellor“ the
“Vice—Chancellor" the “Pro-Vice-Chancellor" of the University;
(d) “Court" means the Conn of the University;
(e) “Director/Principal" means the Head of an “Institution". a College.
Centre and School. or the person appointed for the purpose to act as such in his
absence:
(0 “Department" means a Department of Studies and includes a Centre
of Studies and Research;
(g) “Employee“ means any person appointed by the University, and
includes a teacher or any other member of the staiTof the University;
(h) “Executive Council" means the Executive Council ofthe University;
(i) “Existing College“ means a college or an institution which imparts
professional education and is proposed to be merged. run and maintained by the
University; I
(j) “Faculty" means a Faculty of the University;
(k) “Hostel" means Scholar/Students Hostel of the University;
(1) “Institution/College” means a college including existing college or an
institution established or maintained by or associated to or constituent of the
University in accordance with this Act and the Statutes. V
(m)“Prescribed“ means prescribed by Statutes;
(n) “Records and Publications” means the Records and Publications of
the University; I
(0) “Regulatory Body" means the statutory bodies established by the
Central Government from time to time such as University Grants Commission
’ and includesthe All lndia Council for Technical Education, the Bar Council of
lndia. the DiSIance Education Council, the Dental Council of lndia,.the lndian
Nursing Council. the Medical Council of India. the National Council for
Teacher Education. Central Council for Indian Medicine, the Pharmacy Council
of lndia,
(p) “Statutes" and “Ordinances" means respectively, the Statutes and the
’ Ordinances 'of the University for the time being in force;
(q) “Student" means a student emailed in the register ofthc'Univcrsity:
(r) “Teacher of the University“ means Professors. Associate Professors.
Assistant Professors. and such other persons as may be appointed for imparting
education instructions. or conducting research in the University and are
designated as Teachers by the Ordinances;
(s) “Treasurer". “Registrar". “Deputy Registrar“, “Finance Officer",
Controller of Examinations"; “Librarian". or “Proctor" means respectively the '
Treasurer, the Registrar. the Deputy Registrar. the Finance Ofliccr. the
Controller of Examinations. the Librarian or the Proctor of the University;
14:. KPH Dma t Viomt:
. . .
At? Ilta &MINT fluid, 24 2015 17
"Trust" means Shri Jagdish Jan Kalyan Educational Trust.
Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Trust
Act,1882.
"University" means the J.S University Shikohabad, Firozabad, Uttar
Pradesh eastablished•under section 3.
(1) There shall be established at Shikohabad in district Firozabad of Uttar
Pradesh by the Trust, Shri Jagdish Jan Kalyan Educational Trust, Shikohaliad, Firozabad
a *not for profit' Trust registered under the Indian Trust Act,1882 a University in the
name ofJ.S University Shikohabad, Firozabad, Uttar Pradesh.
(2) The University shall be a body corporate.
The sponsoring body, the Trust shall, for the purposes of establishing the
University under this Act, fulfill the following conditions, namely:-
create a Permanent Endowment fund with minimum of Rs. 10 (ten)
crore;
duly possess minimum 40 acres contiguous land earmarked for the
University;
construct on land referred to in clauses (b) buildings of at least 24000
sq. meter carpet area, out of which at least 50 per cent shall be utilized for
academic and administrative purposes;
install equipments, computers, fumitures, assets, infrastructural
facilities [other then building 'mentioned in (b) above] and other consumables
and non consumables of 'minimum Rs. I (one) crore in offices and laboratories
in the building referred to in clause (b). and an undertaking of procuring the
computers, fumitures, assets, infrastructural facilities [other than building
mentioned in (b) above] and other consumables and non consumables of
minimum four crore rupees in the next 5 years;
appoint at least one Professor. two Associate Professors and
sufficient number of Assistant Professors and supporting staff members in every
department or discipline.
purchase of books and periodicals worth Rs. 10 lalch in the library and
also undertake to invest Rs. 50 lakh for the books , periodicals , computer
library networking and other library facilities in the first three years;
undertake to arrange the co-curricular activities, ' extracurricular
activities, debate, competitions, quiz programmes. sports, NSS and NCC for the
student's as Per the standards of regulatory bodies;
standards and conditions set by UGC, AICTE, NCTE, BCI and other
regulatory bodies established by the State or Central Governments are to be
satisfied;
undertake to establish the provident fund for the employees of the
' University and to introduce other welfare schemes;
(j) make the Statutes and the Ordinances for the administration and
functioning of the University;
(k) any arrangements made by the University shall not differ from the
provisions of the Act and regulations of the University Grants Commission and
other regulatory bodies.
Establishment of
the University
Conditions for
the establishment
of the University

5%:
an? new Warm. 24 112015
l7
M
(t) “Tmst” means Shri Jagdish Jan Kalyan Educational Trust.
Shikohabad, F irozabad a ‘not for profit‘ Trust registered under the Indian Trust
Act,1882.
(u) “University“ means the 1.5 University Shikohabad, Firezabad, Uttar
Pradesh eastablished-under section 3. l
3. (1) There shall be established at Shikohabad in district Firozabad of Uttar
Pradesh by the Trust. Shri Jagdish Jan Kalyan Educational Trust, Shikohabad, Firozabad
a ‘not for profit’ Trust registered under the Indian Trust Act,1882 a University in the
name of J .S University Shikohabad, Firozabad. Uttar Pradesh.
(2) The University shall be a body corporate.
4. The sponsoring body, the Trust shall. for the purposes of establishing the
University under this Act, fulfill the following conditions, namely:-
(a) create 2 Permanent Endowment fund with minimtim of Rs. l0 (ten)
crore;
(b) duly possess minimum 40 acres contiguous land earmarked for the
University:
((2) construct on land referred to in clauses (b) buildings of at least 24000
sq. meter carpet area. out of which at least 50 per cent shall beIutilized for
academic and administrative purposes; '
(d) install equipments, computers, furnitures, assets, infrastructural
facilities [other then building‘mentioned in (b) above] and other consumables
and non consumables of 'minimum Rs. 1 (one) crore in offices and laboratories
in the building referred to in clause (b). and an undertaking of procuring the
computers, firmitures,‘ assets, infrastructural facilities [other than building
mentioned in (b) above] and other consumables and non consumables of
minimum four crore rupees in the next 5 years;
(e) appoint at least one Professor. two Associate Professors and
sufficient number of Assistant Professors and supporting staff members in every
department or discipline.
(0 purchase of books and periodicals worth Rs. 10 lakh in the library and
also undertake to invest Rs. 50 lakh for the books , periodicals , computer
. library networking and other library facilities in the first three years;
' (g) undertake to arrange the co-curricular activities, extracurricular
activities. debate. competitions. quiz programmes. sports. N55 and NCC for the
students as per the Standards of regulatory bodies:
(h) standards and conditions set by UGC. AlCTE, NCTE. BC] and other
regulatory bodies established by the State or Central Governments are to be
.. satisfied; ' I '
(i) undertake to establish the provident fund for the employees of the
' University and to introduce other welfare schemes;
(i) make the Statutes and the Ordinances for the administration and
ifiinctioning of the University; _ V '
(k) any arrangements made by the University shall not differ from the
’ provisions of the Act and regulations of the University Grants Commission and
other regulatory bodies.
Establishment of
the University
Conditions for
the establishment
ofthc University
tesa....srat71
‘tc-P leaf 3TTEMMT1 41%4d. 24 2015 18
(I) to ensure transparent functioning of the University shall put the
clearances obtained from the Regulatory Bodies in the public domain:
Starting of the
University
Objects of the
University
Powers of the
University
to provide for instruction in such branches of learning as the
University may, from time to time, determine and to make provisions for
research and for the advancement and dissemination of knowledge and skills;
to impart and promote the study of Science, Engineering and
Technology, Architecture, Biomedical Sciences, Medical Sciences, Dental
Sciences, other various Sciences not specifically mentioned. Nursing,
Rehabilitation, Ayurveda, Unani, Homeopathy, Naturopathy, Siddha,
Veterinary Sciences, Agriculture. Pharmacy, Management, Hotel and
Hospitality Management, Law and other Professional courses and also History,
Religions, Culture, Commerce, Economics, Humanities, Philosophy,
Languages, Education, Journalism, Social Sciences, Music, Art, Physical
Education etc. or any 'other subject as decided by Academic Council from time
to time through in-campus, off-campus, offshore-campus and satellite centres or
by conducting centres or by distant educational programmes etc. as decided by
the academic council of the University from time to time;
to honour educational stalwarts and persons of academic eminence
with decoration of professor Emeritus:
246 RPM Data I Ve:1-2015
furnish information to the State Government in the prescribed
format as per periodicity determined by the State Government;
such other conditions as may be required by the State Government to
be fulfilled before the establishment of the University.
5. (1) The University shall start operation only after the State Government
issues to the Trust a letter of authorization for the commencement of the functioning of
the University.
(2) The State Government shall issue the letter of authorization after receipt of
an unambiguous affidavit along with documents from the Trust to the effect that all
conditions referred to in section 4 have been fulfilled.
6. The objects of the University shall be to disseminate and advancement of
knowledge and skill for providing instructional, research and extension of facilities in
such branches of learning as it may deem fit and the University shall endeavour to
provide to students and teachers the necessary atmosphere and facilities for the
promotion of:-
innovations in education leading to restructuring of courses, new
methods of teaching. training and learning including online learning, blended
learning, continuing education and such other modes and. integrated and
wholesome development of personality;
studies in various disciplines;
interdisciplinary studies;
national integration, secularism, social equity and inculcation of
international understanding and ethics.
7. The University shall have the following powers, which it will exercise as
per guidelines and norms as prescribed by UGC and State Government from time to time
namely:-

an? m WWW. 24 Ti, 2015
(l) to ensure transparent functioning of the University shall put the
clearances obtained from the Regulatory Bodies. in the public domain:
(m) fumish information to the State Government in the prescribed
format as per periodicity determined by the State Government;
(n) such other conditions as may be required by the State Government to
be fulfilled before the establishment of the University.
gaming nfthc 5, (1) The University shall stan operation only after the State Government
UniVmi‘Y issues to the Trust a letter of authorization for the commencement of the functioning of
the University.
(2) The State Government shall issue the letter of authorization after receipt of
an unambiguous affidavit along with documents from the Trust to the effect that all
conditions referred to in section 4 have been fulfilled.
Obj-Nisan” 6‘ The objects of the University shall be to disseminate and advancement of
Univmily knowledge and skill for providing instructional, research and extension of facilities in
such branches of learning as it may deem fit and the University shall endeavour to
provide to students and teachers the necessary atmosphere and facilities for the
promotion of:-
(a) innovations in education leading to restructuring of courses, new
methods of teaching. training and learning including online learning, blended
learning. continuing education and such other modes and‘ integrated and
wholesome development of personality;
(b) studies in various disciplines;
(c) interdisciplinary studies;
(d) national. integration, secularism, social equity and inculcation of
international understanding and ethics.
Powers arm: 7‘ The University shall have the following powers, which it will exercise as
unim‘i‘y per guidelines and norms as prescribed by UGC and State Government from time to time
namely:-
(a) to provide for instruction in such branches of learning as the
University may, from time to time, determine and to make provisions for
research and for the advancement and dissemination of knowledge and skills;
(b) to impart and promote the study of Science, Engineering and
Technology, Architecture, Biomedical Sciences, Medical Sciences, Dental
Sciences, other various Sciences not specifically mentioned. Nursing,
Rehabilitation, Ayurveda, Unani, Homeopathy, Naturopathy, Siddha,
Veterinary Sciences. Agriculture. Pharmacy, Management, Hotel and
I Hospitality Management. Law and other Professional courses and also History,
Religions. Culture, Commerce, Economics, Humanities, Philosophy,
Languages, Education, Journalism, Social Sciences, Music, Art, Physical
Education etc. or any iother subject as decided by Academic Council from time
to time through in-campus, off-campus, offshore-campus and satellite centres or
by conducting centres or by distant educational programmes etc, as decided by
the academic council of the University from time to time;
(c) to honour educational stalwarts and persons of academic eminence
with decoration of professor Emeritus:
246 RPM Data 1 Vid-IOIS
\i-cH waTT 3RITEITT4 9.4d, 24 tiff, 2015 - 19
to grant, subject to such conditions as the University may determine,
diplomas or certificates to, and confer degrees or Other academic distinctions on
the basis of examinations, evaluation or any other method of testing of persons,
and to withdraw any Auch diplomas. certificates, degrees or other academic
distinctions fbr good and sufficient cause;
to confer honorary degrees or other distinctions in such manner as
may be prescribed;
(I) to provide education and training including correspondence as such
other courses, to such persons as are not members of the University, as it may
determine;
to institute as per UGC norms and State Government regulations
Directorships, Principal-ships, Professorships, Associate Professorships,
Assistant Professorships, and other teaching or academic posts required by the
University and to make appointments for the same;
to create administrative, ministerial and other posts and to make
appointments thereto;
to appoint/engage persons of eminence, working in any other
University or organization permanently or for a specified period;
to eh-operate, raAlaborate or associate with any other University or
Authority or Institution in India and abroad in such manner and for such
purpose as the University may determine;
to establish and maintain schools, centres, specialized laboratories in
other units for research and instructions as are in the opinion of the University,
necessary for the furtherance of its objects;
(1) to institute and award fellowship' s, scholarships, studentships, medals
and prizes;
to establish and maintain and supervise residences, hostels within the
University and promote the health and general- welfare activities for students
and staff;
to make provisions for research and consultancy, and for that purpose
to enter into such arrangements with other institutions or bodies as the
• University may deem necessary; c.
(o) to declare a centre, an institution, a department, or school, as the case
,• may be, in accordance with the Statutes;
(p) to determine standards in accordance with UGC norms/State norms
for admission into the University, which may include examination, evaluation
• or any other method of testing to ensure quality;
to demand and receive payment of fees and other charges;
to make special arrangements in respect of women and other
disadvantaged students as the University may consider desirable;
• . (s) to regulate and enforce discipline among the employees and students
of the University and take such disciplinary measures in this regards as may be
deemed necessary by the University;
to make arrangements for•promoting the health and general welfare
of the employees of the University;
to receive donations and to acquire, hold, manage and dispose of any
property, movable or immovable for the welfare of the University;

mmmm, 24 G131, 2015 "19
(d) to grant, subject to such conditions as the University may determine,
diplomas or certificates to, and confer degrees or other academic distinctions on
the basis of examinations, evaluation or any other method of testing of persons,
and to withdraw any such diplomas. certificates, degrees or other academic
distinctions for good and sufficient cause;
(e) to confer honorary degrees or other distinctions in such manner as
may be prescribed;
(t) to provide education and training including correspondence as such
other courses, to such persons as are not members of the University, as it may
determine;
(g) to 'institute as per UGC norms and State Govemment regulations
Directorships, Principal-ships, Professorships, Associate Professorships,
Assistant Professorships. and other teaching or academic posts required by the
University and to make appointments for the same; Q,
(h) to create administrative, ministerial and other posts and to make
appointments thereto;
(i) to appoint/engage persons of eminence, working in any other
University or organization permanently or for a specified period;
(1') to co-operate, dollaborate or associate with any other University or
Authority or Institution in India and abroad in such manner and for such
purpose as the University may determine; .
(k) to establish and maintain schools, centres, specialized laboratories in
other units for research and instructions as are in the opinion of the University,
necessary for. the furtherance ofits objects:
(I) to institute and award fellowships, scholarships, studentships, medals
and prizes;
(m) to ”establish and maintain and supervise residences, hostels within the
University and promote the health and general- welfare activities for students
and staff;
" j (n) to make provisions for research and consultancy, and for that purpose
i to enter into such arrangements with other institutions or bodies as the
‘ University may deem necessary; ' °' ‘
(o) to declare a centre, an institution. a department, or school, as the case
I , .i “may be, in accordance with the Statutes;
(p) to_dctermine standards in accordance with UGC nouns/State norms
'fl’for admission into the University, which may include examination, evaluation
. or any other method of testing to ensure quality;
(q) to demand and receive payment of fees and other charges;
(r) to make special arrangements in respect of women and other ‘
disadvantaged students as the University may consider desirable,
" * - . (s) to regulate and enforce discipline among the employees and students
' of the University and take such disciplinary measures in this regards as may be
_ deemed necessary by the University; ,
(t) to make arrangements for'promoting the health and general welfare
of the employees of the University;
(u) to receive donations and to acquire, hold manage and dispose of any ‘
Propeny, movable or immovable for the welfare of the University;
?la
‘3TI.?iT1 affiltfRvI Tr1/47e, 24 ‘9, 2015
Ill I
01:
•...
, .41
;I
:011' In Admission and
Standards
I
H
University open to
all class's and
creeds
Il‘rie
011icers of the
tJniversity
?An RPII Ds v :01
(v) to borrow, mortgage with the approval of the Trust on the security of
the property of the University, money for the purposes of the University;
(w)to appoint either on contract or otherwise, visiting professors emeritus
professors. consultants, fellows, scholars, artists, course writers and such other
persons who may contribute to the advancement of the objects of the
University;
to organize and to undertake extramural studies and extension service;
and
to do all such other acts and things as may be necessary, incidental or
conducive to the attainment of all or any of the objects of the University.
8. (1) Admission to the different academic programmes shall be made in
accordance with the laws and University Grants Commission norms for quality for
the time being in force.
The University shall ensure that the academic standards of the courses
offered by the University are in accordance with the guidelines of the University
Grants Commission and other statutory bodies as the case may be.
The teacher student ratio shall be in accordance with the guidelines of
the University Grants Commission and specific Councils.
Academic performance of the University with respect to standards set
1:iy the UGC/State Government/other Regulatory Bodies shall be periodically
reviewed by a Committee of Academic Experts constituted by the Chancellor
consisting of one Chairman and four members including two members as nominees
of the State Government.
The Chairman and other four expert members shall be from academic
field not below the rank of Professor and from one of the spi-cialization being run
in the University. The report of the Committee shall be submitted to the State
Government by the Chancellor and discussed in the Court of the University for
further, necessary actions. A copy of the report along with the actions taken by the
University shall be sent to the UGC and State Government and also displayed in
the public domain.
9. The University shall be open to persons of either sex and of whatever
race, creed, caste or class, and it shall not be lawful for the University to adopt to
impose on any person any test whatsoever of his religious belief profession in
order to entitle him to be admitted therein as an officer, a teacher, staff member,
student, or to hold any office therein or to graduate thereat:
Provided that reservation in the posts and recruitment of the employees
and reservation of seats for admission in any course of study in. the University for
the students belonging to the Scheduled Castes, Scheduled Tribes and Other
Backward Classes of citizens shall be regulated by the order of the State
Government issued from time to time.
10. The following shall be the officers of the University:-
the Chancellor,
the Pro-Chancellor.
the Vice-Chancellor.

20 an? gen W m .24 aft. 2015 {3,112
. .
. (v) to borrow, mortgage with the approval of the Trust on the security of l
the property of the University, money for the purposes of the University;
(w)to appoint either on contract or otherwise. visiting professors emeritus
professors. consultants. fellows. scholars, artists, course writers and such other
persons who may contribute to the advancement of the objects of the
University;
(x) to organize and to undertake extramural studies and extension service;
and I
(y) to do all such other acts and things as may be necessary, incidental or
conducive to the attainment ofall or any of the objects of the University.
Admission and 8. (l) Admission to the different academic programmes shall be made in
sundms accordance with the laws and University Grants Commission norms for quality for
the time being in force.
(2) The University shall ensure that the academic standards of the courses
offered by the University are in accordance with the guidelines of the University
Grants Commission and other statutory bodies as the case may be.
(3) The teacher student ratio shall be in accordance with the guidelines of
the yniversity Grants Commission and specific Councils.
(4) Academic performance of the University with respect to standards set
by the UGC/State Govemment/other Regulatory Bodies shall be periodically
reviewed by a Committee of Academic Experts constituted by the Chancellor
consisting of one Chairman and four members including two members as nominees _
of the State Government.
(5) The Chairman and other four expert members shall be from academic
field not below the rank of Professor and from one of the specialization being run
in the University. The report of the Committee shall be submitted to the State
Government by the Chancellor and discussed in the Court of the University for
further, necessary actions. A copy of the report along with the actions taken by the
University shall be sent to the UGC and State Govemment and also displayed in
the public domain. '
Univmny 0pm m 9. The University shall be open to persons of either sex and of whatever
a" clnsscs and ', race, creed, caste or class, and it shall not be lawful for the University to adopt to
creeds i . . , . , .
impose on any person any test whatsoever of his religious belief professron in
order to entitle him to be admitted therein as an officer, a teacher, staff member,
student, or to hold any office therein or to graduate thereat 2
Provided that reservation in the posts and recruitment of the employees
and reservation of seats for admission in any course of study in the University for
the students belonging to the Scheduled Castes, Scheduled Tribes and Other
Backward Classes of citizens shall be regulated by the order of the State
Government issued from time to time.
Officers oflhe _ 10. The following shall be the officers ofthe University2~
”mushy (a) the Chancellor,
(b) the Pro-Chancellor.
(c) the Vice-Chancellor.
2th RPM Data I th-L‘tll,‘
‘3T1 Abr 31W1T-TRuf Th-ife, 24 ok-1, 2015 21
(d) the Pro-Vice-Chancellor,
the Director/Principal,
the Registrar,
the Dean of Faculty,
the Dean of Students' Welfare,
the Controller of Examinations,
(j) the Chief Proctor,
(k) the Treasurer,
(I) the Finance Officer, and
(m) such other officers as may be declared by the Statutes to be officers
of the University.
11. (1) The Chancellor shall be appointed by the Management Committee of
the Trust for a period of three years.
(2) The Chancellor shall by virtue of his office, be the Head of the University
and shall constitute interim Executive Council.
(3) The Chancellor may by writing under his hand addressed to the Trust resign
from his office.
12. (1) The Pro:Chancellor shall be appointed by the Management Committee
of the Trust for a period of three years. . .
(2) The Pr&Cliaticellor shall assist the Chancellor in discharging his duties and
preside at the cenvocation in his absence.
—(3) The Pro-Chancellor may in writing under his hand addressed to the
...Chancellor resign from his office.
13. (1) The Vice-Chancellor shall be appointed by the Chancellor in such
manner as may be prescribed, for a period of three years.
(2)11e Vice-Chancellor shall be the principal executive and academic officer
of the University and shall be the Chairman of the Academic Council and Planning
Board of the University, and shall exercise general, supervision and control over the
affairs of the ,University ?and give effect to the decisions of the authorities of the
University. • .
(3) The Vice-Chancellor may, if he is of the opinion that immediate action is
necessary on any matter, exercise any power conferred on any authority of the
University by or. under. this Act and shall convey to such 'authority the action taken by
him on such matters:
Rrovided that if the authority of the University or any person in the service of
the University who is aggrieved by the action taken by the Vice-Chancellor under this
sub-section may prefer an appeal to the Chancellor within thirty days from the date of
corrununication of such decision. The Chancellor may confirm, modify or reverse such
action taken by the Vice-Chancellor.
. (4) The Vice-Chancellor shall exeicise sudh powers and perform such other
functions as may be prescribed.
(1) The Pro-Vice-Chancellor shall be appointed by the Vice- Chancellor in
such manner and shall exercise such powers and fierform such functions as may be
prescribed.
(2) The Pro-Vice-Chancellor appointed under sub-seetion (1) shall discharge his
duties in addition to his duties as a Professor.
The
Chancellor
The Pro-
Chancellor
The Vice-
Chancellor
The Pro-
Vice-
Chancellor

WW}?! Warm .24 GEL 2015
(d) the Pro-Vicé-Chancellor,
(e) the Director/Principal,
(f) the Registrar,
. (g) the Dean ofFaculty,
(h) the Dean of Students' Welfare,
(i) the Controller of Examinations.
g (j) the Chief Proctor,
(k) the Treasurer,
(l) the Finance Officer. and
* (m) such other officers as may be declared by the Statutes to be ofliecrs
_of the University.
ll. (1) The Chancellor shall be appointed by the Management Committee of
the Trust for a period of three years.
(2) The Chancellor shall by virnie of his office, be the Head of the University
and shall constitute interim Executive Council.
(3) The Chancellor may by writing under his hand addressed to the Trust resign
from his off ee
12 (l) The Pro- Chancellor shall be appointed by the Management Committee
of the Trust for a period of three years. . . “ .v
- (2) The Pro-Chancellor shall assist the Chancellor in discharging his duties and
preside at the convocation in his absence.
"‘(3) The Pro-Chancellor may in writing under his hand addressed to the
‘ :Chancellor resign from his office.
13. (l) The Vice- Chancellor shall be appointed by the Chancellor in such
‘ manner as may be prescribed, for a penod of three years.
(2) The Vice-Chancellor shall be the principal executive and academic officer
of the University and shall be the Chairman of the Academic Council and Flaming
Board of the University, and shall exercise general, supervision and control over the
affairs 'of the'I‘Universitygand give effect to the decisions of the authorities of the
University. ,
' t (3) The Vice- Chancellor may if he is of the opinion that immediate action is
necessary on' any matter, exercise any power conferred on any authority of the
. University by or. under this Act and shall convey to such authority the action taken by
him on such matters:
Provided that if the authority of the University or any person in the service of
the University who rs aggrieved by the action taken by the Vice- Chancellor under this
sub- -scction may prefer an appeal to the Chancellor within thirty days from the date of
Commuhication of such decision. The Chancellor may confirm, modify or reverse such
action taken by the Vice-Chancellor. _
(.4) The Vice-Chancellor shall exercise such powers and perform such other
functions as may be prescribed.
14. (l) The Pro- Vice- Chancellor shall be appointed by the Vice- Chancellor in
SuCh manner and shall exercise such powers and perform such functions as may be
Prescribed
(2) The Pro- Vice- Chancellor appointed under sub- -sec'tion ( I) shall discharge his
duties in addition to his duties as a Professor.
2]
. The
Chancellor
The Pm~
Chancellor
The Vice-
Chancellor
Tln: Pro
Vice-
Chancellor
amimmessiSmaeroasse.-
7 2 ‘§-c-N 31t'41- 31-iiRrFut TIVZ,
24 3J9, 2015
A) 4
Director/
Pnncipal
The Registrar
Dean of
Faculty
'The Treasurer
Finance
Officer
Other Officers
Authorities of
the University
The Court
The Pro-Vice- Chancellor shall assist the Vice- Chancellor in discharging
day to day duties as and when required by the Vice- Chancellor.
The Pro-Vice- Chancellor shall get honorarium of such amount as may be
determined by the Trust.
15.The Director/Principal shall he appointed, in such manner and shall exercise
such powers and perform such functions as may be prescribed.
16.0) The Registrar shall be appointed in such manner as may be prescribed.
The Registrar shall have the power to enter into agreements, sign documents
and authenticate records on behalf of the University and shall exercise such other powers
and perform such other functions as may be prescribed.
The Registrar shall be the ex-officio Secretary of the Executive Council and
the Academic Council.
17.Every Dean shall be appointed in such manner and shall exercise such
powers and perform such functions as may be prescribed.
I 8.The Treasurer shall be appointed in such manner and shall exercise such
powers and perform such functions as may be prescribed.
19.0) The Finance Officer shall be appointed in such manner and shall exercise,'
such powers and perform such function § as may be prescribed.
(2) The Finance Officer shall be the ex-officio Secretary of Finance Committee: ,
20.The manner of appointment and powers and duties of the other officers of
the University including the Dean of Students Welfare, Controller of Examinations and
Chief Proctor shall be such as may be prescribed.
21. The following shall be Authorities of the University:-
the Court,
the Executive Council
the Academic Council,
the Finance Committee
the Planning Board.
the Board of Faculties,
the Admissions Committee:
the Examinations Committee and,
such other authorities as may be declared by the Statutes to be
authorities of the University.
22.( I) The Constitution of the Court and the term of office of its members shall
be such as may be prescribed.'
(2) Subject to provisions of this Act the Court shall have the following powers
and functions, namely:-
to review from time to time, the -broad policies and programmes of
the University and suggest measures for the working, improvement and
development of the University:
to consider and pass resolutions on the Annual Report and Annual
accounts of the University and Audit Report of such accounts;
to advise the Chancellor in respect of any matter which may be
referred to it for advice;
to perform such other functions as may be prescribed.
244 RN I Data I Vi42015

am new W 1m, 24 fifi. 2015
;_—————_———_———’_-————
(3) The Pro—Vice- Chancellor shall assist the Vice- Chancellor in discharging
day to day duties as and when required by the Vice- Chancellor.
(4) The Pro-Vice- Chancellor shall get honorarium of such amount as may be
determined by the Trust.
Dimmer; 15.The Director/Principal shall be appointed, in such manner and shall exercise
Pl""CiF'a' such powers and perform such functions as may be prescribed.
11.c chislm, 16.(l) The Registrar shall be appointed in such manner as may be prescribed.
(2) The Registrar shall have ihe power to enter into agreements, sign documents
and authenticate records on behalf of the University and shall exercise such other powers
and perform such other functions as may be prescribed.
(3) The Registrar shall be the ax—oflcio Secretary of the Executive Council and
the Academic Council.
m as» ass-«v.15:
Dcanof l7.F.very Dean shall be appointed in such manner and shall exercise such
Faculty powers and perform such functions as may be prescribed.
. . l8.'l'he Treasurer shall be appointed in such manner and shall exercise such
I‘helrmsurer
powers and perform such functions as may be prescribed.
Finance
Officer such powers and perform such functions as may be prescribed.
(2) The Finance Officer shall be the ex-oflcio Secretary of Finance Committee: .'
20.The manner of appointment and powers and duties of the other officers of
l9.(l) The Finance Officer shall be appointed in such manner and shall exercisef
u—‘ahn‘w
new .. ... _
Other Oflicers
the University including the Dean of Students' Welfare, Controller of Examinations and
ChicfProctor shall be such as may be prescribed.
Authorities of 21. The following shall be Authorities of the University:-
the University , (a) the Court,
(b) the Executive Council ,
(c) the Academic Council.
(d) the Finance Committee ,
(e) the Flaming Board.
(0 the Board of Faculties.
(g) the Admissions Committee -
(h) the Examinations Committee and ,
(i) such other authorities as may be declared by the Statutes to be
authorities of the University.
The Conn 22.( l) The Constitution of the Court and the term of office of its members shall
be such as may be prescribed.’
(2) Subject to provisions of this Act the Court shall have the following powers
and functions, namely:- ‘
(a) to review from time to time, the‘broad polidies and programmes of
the University and suggest measures for the working, improvement and
development ot‘the University:
(b) to consider and pass resolutions on the Annual Report and Annual
accounts of the University and Audit Repon of such accounts. .
(c) to advise the Chancellor in respect of any matter which may be
referred to it for advice;
(d) to perform such other functions as may be prescribed.
240 RP” Date I Vid‘ZOIS
0 1
‘3c1' 31t4T 31911B7U1 II WC, 24 Wff, 2015
*Val
23. (I) The Executive Council shall be the principal executive body of the The Eiecutive
University. Council. .
The Constitution of the Executive Council, the term of the office of its
menibers and its powers and duties shall be such, as may be prescribed.
Joint Secretary to the Government of Uttar Pradesh shall be the member of
the Executive Council.
24..(1) The Academic Council shall be the principal academic body of the.
University and shall subject to the provisions of the Statutes and the Ordinances, co-
ordinate and exercise general supervision over the academic policies of the University.
(2) The constitution of the Academic Council, the term of office of its members
and its powers and functions shall be 'such, as may be prescribed.
(I) The Finance Committee shall be the principal financial body of the
University to take dare of the financial matters.
(2) The constitution powers and functions of the Finance Committee shall be
such, as may be prescribed.
(1) The Planning Board shall be the principal planning body of the
University. The Board shall ensure that the infrastructure and academic support system
meets the norms of the University Grants Commission or the respective Councils.
(2) The constitution, of the Planning Board, term of office of its members and
its power and functions shall be such as may be prescribed.
The constitution, powers and functions of the Board of Faculties, the
Admissions Committee, the Examination Committee and of such other authorities of the
University which may be declared by the Statutes to be authorities of the University shall
be such as may be prescribed.
28. (1) The. Executive Council shall make the statutes of carrying out the
purposes of this Act.
(2) Subject to the provisions of this Act the Statutes may provide for all or any
of the following matters, namely:-
the constitution, powers and functions of the authorities of the
University, as may be constituted from time to time;
the appointment and continuance in office of the members of the said
authorities, filling of vacancies of members of the said authorities, filling of
vacancies of members and all .other matters relating to those authorities for
which it may be necessary to provide;
the appointment, powers and duties of the officers of the University
and their emoluments;
the appointment of teachers of the University and other academic and
'administrative staff and their emoluments;
the appointment of teachers and other academic and administrative
staff working in the University or Institution for specific period for undertaking
a 'joint project;
the conditions of Service of employees including provisions for
retirement benefits, insurance and provident fund, the manner of termination of
service and disciplinary actions;
The Academic
Council
The Finance
Committee
The Planning
Board
Board of
Faculty,
Admission
Committee,
Examination
Committee
and other
Authorities of
the University
Power to make
statutes
fr

‘ an? steer. ,amtww m. 24 aft, 2015
i 23. (l) The Executive Council shall be the principal executive body 'of the
University.
(2) The Constitution of the Executive council, 'the term of the office of its
members and its powers and duties shall be such, as may be prescribed.
(3) Joint Secretary to the Government of Uttar Pradesh shall be the member of
the Executive Council.
24..(1) The Academic Council shall be the principal academic body of the.
University and shall subject to the provisions of the Statutes and the Ordinances, co-
ordinate and exercise general supervision over the academic policies of the University.
(2) The constitution of the Academic Council, the term of office of its members
and its powers and functions shall be 'such, as may be prescribed.
25. (l) The Finance Committee shall be the principal financial body of the
University to take care of the financial matters.
(2) The constitution powers and functions of the Finance Committee shall be
such. as may be prescribed.
26, (l) The Flaming Board shall be the principal planning body of the
University. The Board shall ensure that the infrastructure and academic support system
meets the norms of the University Grants Commission or the respective Councils.
. (2) The constitution, of the Planning Board. term of office of its members and
its power and functions shall be such as may be prescribed.
27. The constitution. powers and functions of the Board of Faculties, the
Admissions Committee, the Examination Committee and of such other authorities of the
University which may be declared by the Statutes to be authorities of the University shall
be such as may be prescribed.
28. (l) The Executive Council shall make the statutes of carrying out the
purposes of this Act.
(2) Subject to the provisions of this Act the Statutes may provide for all or any
ofthc following matters, namely:-
7 (a) the constitution. powers and functions of the authorities of the
’I University, as may be constituted from time to time; .
(b) the appointment and continuance in office of the members of the said
authorities, filling of vacancies of members of the said authorities, filling of
: vacancies of members and all other matters relating to those authorities for
which it may be necessary to provide; 1
(c) the appointment, powers and duties of the officers of the University
and their emoluments;
(d) the appointment of teachers of the University and other academic and
'administrative staff and their emoluments;
(e) the appointment of teachers and other academic and administrative
staff working in the University or Institution for specific period for undertaking
‘ajoint project;
(0 the conditions of service of employees including provisions for
' retirement benefits insurance and provident fund the manner of termination of
service and disciplinary actions;
”23,‘ .4
The Executive
Council
' . The Academic
Council
The Finance
Committee
The Planning
Board
Board of
Faculty.
Admission
Committee,
Examination
Committee
and other
Authorities of
the University
Power to make
statutes
•••,% ,1
.,
A
.4
rtf i;
1.•
1, ra
II :ft!
[••••re'l
It
‘ir
Ilr
.1.:
24 dri•( TraTI 31711tIT71
1IulC. 24 ‘9, 2015
the principles governing seniority of service of employees;
the procedure for settlement of disputes between employees or
students and the University;
the procedure for appeal to the Executive Council by any employee
or students against the action of any officer or other authority of the University;
the conferment of honorary degrees;
the withdrawal of degree, diploma, certificate and other academic
distinctions;
(I) the institution of fellowships, scholarships, studentships, medals and
prizes;
the maintenance of discipline among the students;
the establishment and abolition of Department, Centers and othei
constituent institutions / colleges etc;
the delegation of powers vested in the authorities or officers of the
University; and
all other matters, which are in this Act or may be prescribed.
The Executive Council shall not make, amend or repeal any Statute affecting
the powers or constitution of any authority of the University until such authority has been
given an opportunity of expressing an opinion in writing on the proposed changes and
any opinion so expressed shall be considered by the Executivt. Council.
Notwithstanding anything contained in the foregoing sub-sections the
Chat :I tor may direct the University to make provisions in the Statutes, in respect of any
matter specified by him and if the Executive Council is unable to implement such a
direction within sixty drfys of its receipt, the Chancellor may, after considering the
reasons, if any, communicated by the Executive Council for its inability to comply with
such direction, make or amend the Statutes accordingly as he may deem fit.
29. Subject to the provisions of this Act and the Statutes, the Ordinances shall
Power to make •
Ordinances
be made by the Executive Council which may provide for all or any of the following
matters, namely:-
the admission of students to the University and their enrolment as
the courses of study to be laid down for all degrees, diplomas and
certificates of the University;
the medium of instruction and examination;
the award of degree, diploma, certificate and other academic .
distinction, the qualification for the same and the means to be taken relating to
the granting and obtaining of the same;
the fees to be charged for courses of study in the University and for
admission to the examinations, degrees, diplomas and certificates of the
University;
the conditions for the award of fellowships, scholarships,
studentships, medals and prizes;
the conduct of examinations, including the term of office and manner
of appointment and the duties of examining bodies, examiners and moderators;
the conditions of residence of the students of the University;
the special arrangements, if any, which may be made for the
residence, discipline and teaching of women students and prescribing of special
courses of studies for them within the University;
2.16 IIPH Da I Vid-2015
MI ILL
-
such;

l i 24 ' WWWWJAVfimis - his”;
“ I (g) the principles governing seniority of service of employees;
(h) the procedure for settlement of disputes between employees or
students and the University;
(i) the procedure for appeal to the Executive Council by any employee
or students against the action of any officer or other authority of the University;
(j) the conferment of honorary degrees;
(k) the withdrawal of degree, diploma, certificate and other academic
distinctions;
(l) the institution of fellowships, scholarships, studentships, medals and
prizes;
(rn) the maintenance of discipline among the students;
(n) the establishment and abolition of Department, Centers and other
constituent institutions / colleges etc;
(o) the delegation of powers vested in the authorities or officers of the
sa— -ziarzza
W.»
University; and
(p) all other matters. which are in this Act or may be prescribed.
(3) The Executive Council shall not make, amend or repeal any Statute affecting
the powers or constitution of any authority of the University until such authority has been
given an opportunity of expressing an opinion in writing on the proposed changes and
any opinion so expressed shall be considered by the Executiv Council.
(4) Notwithstanding anything contained in the foregoing sub-sections the
Cha- ellor may direct the University to make provisions in the Statutes, in respect of any
‘ matter specified by him and'if the Executive Council is unable to implement such a
direction within sixty days of its receipt, the Chancellor may, after considering the
reasons, if any, communicated by the Executive Council for its inability to comply with
such direction, make or amend the Statutes accordingly as he may deem fit.
29‘ Subject to the provisions of this Act and the Statutes, the Ordinances shall
Power to make ' ‘
be made by the Executive Council which may provide for all or any of the following
Ordinances
matters, namely:-
(a) the admission of students to the University and their enrolment as
such;
(b) the courses of study to be laid down {or all degrees, diplomas and
certificates of the University; _ ' I.
(c) the medium of instruction and examination;
(d) the award of degree, diploma, certificate and other academic .
distinction, the qualification for the same and the means to be taken relating to
the granting and obtaining of die same; ,
(e) the fees to be charged for courses of study in the University and for
admission to the examinations, degrees, diplomas and certificates of the
University; .
(f) the conditions for the award of fellowships, scholarships.
studentships. medals and prizes;
(g) the conduct ofexaminations, including the term of office and manner
of appointment and the duties of examining bodies. examiners and moderators;
(h) the conditions of residence of the students of the University;
(_ i) the special arrangements, if any. which may be made for the
residence, discipline and teaching of women students and prescribing of special
courses of studies for them within the University;
246 H?“ D.“ l \'id 2015
‘tcti ptra 371191Vu1 , 24 i, 2015
•
the appointment and emoluments of employees other than
those for whom provision has been made in the Statutes;
the establishment of Centre of Studies, Board of Studies,
Interdisciplinary Studies. Special Centers, Specialized Laboratories and
other Comniittees;
(I) the manner of co-operation and collaboration with other
Universities and authorities including professional bodies or
associations; .
the creation, composition and functions of any other body
which is considered necessary for improving the academic stature of
the University;
the remuneration to be paid to the examiners, moderators,
invigilators and tabulators; and
(o) such other terms and conditions of service of teachers and
Other academic staff as are not prescribed by the Statutes.
30. (1) The Annual Report to the University shall be prepared under the Annual Report
direction of the Executive Council and shall be submitted to the Court on or after such
date as may be prescribed and the Court shall consider the report in its annual meeting;
. (2) The Court shall submit the Annual Report to the Chancellor along with its
,comments, if any.
.31. (ft The Annual Accounts and Balance Sheet of the University shall be Annual
prepared under the directions of the Executive Council and shall, once at least every year Accounts
and at intervals of not more than fifteen months, be audited by an experienced and
qualified firm of Chartered Accountants of repute.
(2) A copy of the Annual Accounts, together with the audit report thereon, shall
be submitted to the Court and the Chancellor along with the observations of the
Executive Council. • . . •
(3) Any obkrvations -made by the Chancellor on the annual accounts shall be
bfought to the notice of the -Court and the Executive (Council and the observations, if
any, shall after review by the Executive Council, be submitted to the Chancellor and
shall be put in the public domain. .
32. (1) Every empitiyee of the University shall be appointed/engaged as per Conditions of
-Provisions of the Statutes. service of
employees
7 (2) Any dispta arising between the University and any of the employees
appointed substantively, shall be referred to the .Vice Chancellor who shall decide the
dispute after affording an opportunity, to the employee within three months from the date
of its reference.
(3) The aggrieved employee may file an appeal against the order of the Vice-
Chancellor to the Chancellor.
(4) Any dispute in respect of any employee engaged temporarily or on ad-hoc or
Pan time or casual basis snail be heard and decided by the Vice-Chancellor.
(5) Any person aggrieved by the order of the Vice-Chancellor may prefer an .
appeal to the Chancellor. The decision of the Chancellor in such an appeal shall be final ,
and no suit shall lie in any court in respect. of the matters decided by the Chancellor.
33. (1) Any student or candidate for an examination, whose name has been Right to •
c.
removed from the lolls of the University by the orders or resolution of the Academic Appeal

wafiasmwwm, 24 an, 2015_
{I . ' (j) the' appointment and emoluments of employees other than
those for whom provision has been made in the Statutes; _
(k) the establishment of Centre of Studies Board of Studies,
Interdisciplinary Studies Special Centers Specialized Laboratories and
other Committees;
(1) the manner of co-operation and collaboration with other
Universities and authorities including professional bodies or
‘-. V .. . associations;. .
t (m) the creation, composition and functions m" any other body
which is considered necessary for improving the academic stature of
the University; I . , '
(n)' the remuneration to be paid toithe examiners, moderators,
t invigilators and tabulators; and I
; ‘ . (0) such other terms and conditions of service of teachers and
other academic staff as are not prescribed by the Statutes
-30. (l) The Annual Report to the University shall be prepared under the
direction of the Executive Council and shall be submitted to the Court on or nfler such
date as may be prescribed and the Court shall consider the report in its annual meeting;
(2) The Court shall submit the Annual Repon to the Chancellor along with its
,corttment; if any i
, (l) The Annual Accounts and Balance Sheet of the University shall be
, prepared3 under the directions of the' Executive Council and shall. once at least every year
and at intervals of not more than fificen months. be audited by an experienced and
qualified firm of Chartered Accountants of repute '
(2) A copy of the Annual Accounts, together with the audit report thereon, shall
be submitted to the Court and the Chancellor along with the observations of the
‘ Executive Council. ’ I
(3) Any obié‘gwations-made by the Chancellor on the annual accounts shall be
- brought to the notice of theCo‘un and the ExecutiveiCouncil and the observations, if
any, shall after review by the Executive Council, besubmitted to 'the Chancellor and
shall be put in the public domain.
. l f 32. (1) Every employee of the University shall be appointed/engaged as per
provisions of the Statutes.
‘r (2) Any dispute‘ arising between” the University and any of the employees
’ appointed substantively, shall be referred to the_Vice Chancellor who shall decide the
j ‘r ‘ l - dispute after affording an opportunity, to the employee within three months from the date
of its reference. ,
. (3) The aggrieved employee may file an appeal against the order of the Vice-
Chancellor to the Chancellor.
L.” (4) Any dispute in respect ofany employee engaged temporarily or on ad~ltoc or
pan time or casual basis shall be heard and decided by the Vice-Chancellor I
(5) Any person aggrieved by the order of the Vice—Chancellor may prefer an .
appeal to the Chancellor The decision of the Chancellor tn such an appeal shall be final
and no suit shall lie in any court in respect of the matters decided by the Chancellor.
33‘ (1) Any student or candidate for an examination. whose name has been
rBmo‘ved from the rolls of the University by the orders or resolution of the Academic
25-
Annual Repon '
Annual
Accounts
Conditions of
. service of
employer:
Right to '
Appeal
26 \i-cH tI 3Fil1t.R77
11-‘71Z, 24 WI, 2015
Employees
Provident Fund
and Pensions
Disputes as to
the constitution
of Authonties
and bodies
Constitution of
Committees
Filling of the
vacancies
Invalidity of
proceeding
Mode of proof
of University
records
Publication of
Statutes and
Ordinance
Permanent
Endowment
Fund
General Fund
246 KPH Data I Vid.7.111!
Council, Proctorial Board or Controller of Examinations as the case may be and who has
been debarred from appearing at the examinations of the University for more than one
year, may within ten days of the date of receipt of such orders or copy of such resolution
appeal in writing to reverse the decision to the aforesaid authorities or the concerned
Committee, as the case may be.
(2) Any decision taken by the Vice-Chancellor shall be final.
The University may constitute for the benefit of its employees such pension or
welfare schemes or Provident Fund or provide such insurance schemes as it may deem fit in
such manner and subject to.such conditions as may be decided by the Executive Council.
If. any. question arises as to whether any person has been duly nominated or
appointed as or is entitled to be a member of any authority or other body of the University, the
matter shall be referred to the Chancellor whose decision thereupon shall be final.
Where any authority of the University is liven power under this Act or the
Statutes to appoint Committees, such Committees shall save as otherwise Provided, consist of
the members of the authority concemeland of such other persons as the authority in each
case may think fit.
All vacancies among the members (other than ex-officio) of any authority or
other body of the University shall be filled as soon as may be convenient by the person or
body who appointed, nominated or co-opted the members whose place has become vacant for
the remaining term for which he has been apPointed or co-opted.
38.No act or proceedings of any authority of the University shall be invalid merely
by reason of the existence of a vacancy or vatancies among its members.
A copy of any receipt. application, notice, proceeding, resolution of any
authority or Committee of the University or other documents in possession of the University,
if certified by the Registrar, shall be received as prima-facie evidence of the such receipt,
applications. notice. order, proceeding or resolution, documents or the existence of entry in
the register and shall be admitted as evidence of the matters and transactions therein where
the original would. if produced have been admissible in evidence.
(1) Every Statute or Ordinance made under this Act shall be made available in
writing.
(2) Each new Statute or Ordinance made under this Act shall be enforced as soon as
it is made by the competent authority.
41. (1) The Trust shall establish a permanent Endowment Fund of at least rupees ten
crore as per law and no money shall be withdrawn from the principal amount of this fund
without prior permission of the State Government.
The University shall have the power to invest the permanent 'Endowment Fund
in such manner as may be prescribed.
The University may transfer any amount from the general fund or the
development fund to the permanent endowment fund.
Any amount exceeding the minimum amount specified in sub-section 111 may
be withdrawn from the permanent endowment fund by the University for the purposes of
development of the University.
42(1) The University shall establish a general find to which the following amount
shall be credited. namely. -
all J..c. which may be charged by the University:
all sums received from any other sources:
ci all contributions trade by the Trust: and

WWW‘W .24aft.2015
I, t 26 ..
Employees
Provident Fund
and Pensions
DispukS as to
the constitution
of Authontres
and bodies
Constitution of
Committees
Filling of the
vacancies
invalidity of
proceeding
Mode of proof
of University
records
Publication of
Statutes and
Ordinance
Pemiancnt
Endowment
Fund
General Fund
11(- Kl'li Data \ \‘idalUl.’
Council, Proctorial Board or Controller of Examinations as the case may be and who has
been debarred from appearing at the examinations of the University for more than one
year, may within ten days of the date of receipt of such orders or copy of melt resolution
appeal in writing to reverse the decision to the aforesaid authorities or the concemcd
Committee. as the case may be.
(2) Any decision taken by the Vice»Chancellor shall be final.
34, The University may constitute for the benefit of its employees such pension or
welfare schemes or Provident Fund or provide such insurance schemes as it may deem {it in
such manner and subject to‘such conditions as may be decided by the Executive Council.
35. If. any' question arises as'to whether any person has been duly nominated or
appointed as or is entitled to be a member of any authority or other body of the University, the
matter shall be referred to the Chancellor whose decision thereupon shall be final.
36.Where any authority of the University is given power under this Act or the
Statutes to appoint Committees, such Committees shall save as otherwise provided. consist of
the members of the authority concemed'and of such other persons as the authority in each
one may think fit.
37.All vacancies among the members (other than ex-ajiicia) of any authority or
other body of the University shall be filled as soon as may be convenient by the person or
body who appointed, nominated or coepted the members whose place has become vacant for
the remaining term for which he has been appointed or co—opted.
38.No act or proceedings of any authority of the University shall be invalid merely
by reason of the existence of a vacancy or vaCancies among its members.
39. A copy of any receipt. application, notice, proceeding, resolution of any
authority or Committee of the University or other documents in possession of the University,
if certified by the Registrar: shall be received as prima—facie evidence of the such receipt.
applications. notice. order. proceeding or resolution, documents or the existence of entry in
the register and shall be admitted as evidence of the matters and transactions therein where
the original would. ifproduced have been admissible in evidence.
40. (1) Every Statute or Ordinance made under this Act shall be made available in
writing.
(2) Each new Statute or Ordinance made under this Act shall be enforced as soon as
.it is made by the competent authority.
41 . (1) The Trust shall establish a pennanent Endowment Fund of at least nipees ten
crore as per law and no money shall be withdrawn front the principal amount of this fund
without prior permission of the State Govemment
(2) The University shall have the power to invest the pennancnt Endowment Fund
in such manner as may be prescribed.
(3) The University may transfer any amount from the general fund or the
development fund to the permanent endowment fund
(4) Any amount exceeding the minimum amount specified in sub-section (ll may
be withdrawn born the pemianent endomncnt fund by the University for the purposes of
development of the University.
42.0) The University shall establish a general fund to which the following amount
shall be credited. namely
(a) all t which may be “hurt-ted by the University:
(bl allsui :rcceivcdfmm anyuthcrsources:
(c) all contributions made by the Trust: and
‘311N 747( 31774R1:11 410Id. 24 , 2015
(d) all contributions made in this behalf by any other person or bodies which are
I
not prohibited by any law for the time being in force.
(2) The money credited to the general fund shall be applied to meet all the recurring
1 expenditures of the University.
43. (1) .The University shall also establish a developthent fund to which the
. following moneys shall be credited, namely :—
(a) development fees, which may be charged from students;
. . (b) all sums received from other sources for the purpose of the development
of the University;
all contributions made by the Trust: •
all contributions made in this behalf by any other person or bodies which
are not prohibited by any law for the time being in force; and
all incomes received from the pennanent endowment fund.
(2) The moneys credited to the development fund from time to time shall be utilized
for the development of the University.
44. The funds established under sections 41, 42 and 43 shall Subject to general
supervision and control of the Court be regulated and maintained in such manner as may be
prescribed.
. 45. The University shall not be eligible for, any grants in aid or any financial
assistance from the State Government or any other body or Corporation owned and controlled
by the State Government.
f ,73
The fees charged for different academic programmes shaffibe in accordance
with laws for the time being in force and the fees structure shall be put in public domain.
(1) It shall be the duty of the University or any authority or officer of the
University to furnish such information or records relating to the administration or finance and
other affairs of the University as the State Government may call for.
(2) The State Government, if it is of the view that there is a violation of the Act or
the Statutes or Ordinances made hereunder may issue such directions to the UniVersity under
section 51 as it may deem necessary.
( 1 ) If the University proposes its dissolution' in accordance with the law
governing its constitution or incorporation, it shall give at least six months written notice to
the State'Govemment.
(2) On receipt of notice referred to in sub-section (I) the State Government shall
make such arrangements for administration of the University from the date of dissolution of
the University and until the last batch of students in regular courses of studito1 the
University complete their courses or studies in such manner as may be prescribed.
. 49. (I ) The expenditure for administration of the University during the taking over
the liabilities of the University under section 48 shall be met out of the Permanent
Endowment Fund, the general fund and the development fund.
(2) If the funds referred to in sub-section (1) are no; sufficient to meet the
expenditure of the University during the taking over the liabilities of the University such
expenditure may be met by disPOsinu off the properties dr assets of the University by the
State Govemn. lent.
50. (1) Where the State Government receives a complaint that the University is not
functioning in accordance with the provisions of this Act. it shall require the University to
Show cause within such time, which shall not be less than sixty days. as to why the University
should not be derecognized.
Development
Fund
Maintenance
of Funds
c•„
Financial
Condition
Fees
Power of
State
Government
to call for
infonnat ion
and records
Dissolution of.
University
Expenditure
of the
University
during
dissol Lit 1011
De-recognition of
the University by
the State
Government

g
-.—‘-v—’~
‘- ;wj—i ill—v 14 A:
:u- 7~
wrv: -' ;
7"; ante-m- - - A; _._.._.
”31-4—3, .A 4: ~¢wcww mm,‘: 4 “gawk-mg»:
an? steer Wt we, 24 Gift. 2015 27
. (d). all contributions made in this behalf by any other person or bodies which are
not prohibited by any law for the time being in force. ‘
(2) The money credited to the general fund shall be applied to meet all the recurring
expenditures of the University. I
43. (1) _The University shall also establish a development fund to which the D’cvdopmcm
following moneys shall be credited, namely :—
(a') development fees which may be charged from students;
.(b) all sums received from other sources for the purpose of the development
of the University;
(c) all contributions made by the Trust:
(d) all contributions made in this behalf by any other person or bodies which
are not prohibited by any law for the time being in force: and
. . /- 4 E
(c) all incomes received from the permanent endowment fund “
(2) T he moneys credited to the development fund fi'om time to time shall be utilized
for the development of the University . C‘
44 The funds established under sections 4] 42 and 43 shall subject to general
supervision and control of the Court be regulated and maintained in such manner as may be
prescribed, V .
. 45. The University shall not be eligible for any grants in aid or any financial
assistance fi-om the State Government or any other body or Corporation owned and controlled
by the State Government
6 '1}
46 The fees charged for different academic programmes shall be in accordance
‘ with laws for the time being in force and the fees structure shall be put in public domain.
47 (1) It shall be the duty of the University or any authority or officer of the
University to furnish such infomiation or records relating to the administration or finance and
other affairs of the University as the State Govenirnent may call for
(2) The State Govemnient. if it is of the view that there is a violation of the Act or
the Statutes or Ordinances made hereunder may issue such directions to the University under
section Sl as it may deem necessary.
48. (1) If the University proposes its dissolution‘ in accordance with the law
governing its constitution or incorporation. it shall give at least six months written notice to
the Statc‘Govemment. ”
(2) On receipt of notice referred to in sub-section (1) the State Govenuncnt shall
make such arrangements for administration of the University fiom the‘date of dissolution of
the University and until the last batch of students in regular courses of studies-lief the
University complete their courses or studies in such matuier as may be prescribed
. 49. (.l) The expcndiiure for administration of the University during the taking over
lite liabilities of the University under section 48 shall be met out of the Permanent
Endowment Fund. the general fund and the development fund.
(2) if 1110 funds referred to in subsection (1) are not sufficient to meet the
S‘Pcnditttrc of the Uitive.sit\ during the taking over the liabilities oi the University such
e’ilitcnditure may be met by disposing off the prepcrties o'i assets of the Universitv bv the
State Govei’tmient.
50 (1) Where the State Govemmctit receives a complaint that the University is not
fUnctioiiing ui accordance with the provisions of this Act. it shall require the University to
Show cause within such time which shall not be less than sixu davs. as to win the U ivcrsity
Fund
Maintenance
of Funds
Financial
Condition
F ecs
Power of
State
Government
to call for
information
and records
Dissolution of
University
Expenditure
ofthc
Uni\ cisity
duiiiiF
dissu iiiion
Oc-rccognition of
the University by
the State
Government
28 ri
317H1T.11701 WO, Z, 24 ZVI, 2015
Power of the
State
Government to
issue directions
on policy mnners
Status of Assets'
liabilities on
dissolution/ de-
n:cognition
Power to remove
difficulties
I
(2) If, upon receipt of the reply of the University to the notice given under sub-
section (1), the State Government is satisfied that a prima-facie
case of mismanagement or
violation of the provisions of this Act in the functioning of the University is made out, it shall
order such enquiry as it deems necessary.
(3) For the purpose of an inquiry under sub-section (2), the State Government shall
by notification, appoint an officer or authority as the enquiring authority to enquire into the
allegations of violation of the provisions of this Act.
(4) Every inquiring authority appointed.under sub-section (3) shall while performing
its functions under this Act have all the powers of Civil Court under the Code ,_ f Civil
Procedure. 1908 trying a suit and in particular in respect of the following matters, namely:-
summoning and enforcing the attendance of any witness and examining
him on oath;
requiring the discovery and production of any document;
requisitioning any public record or copy thereof from any office:
receiving evidence on affidavits: and
any other matter which may be prescribed.
(5) If. upon receipt of the inquiry report. the State Government is satisfied that the
University has violated any provisions of this Act, it shall direct the University to make
necessary improvement and suggest for proper implementation of the provisions of this Act.
(6) If 'it is observed that the University is violating the provisions of this Act
continuously for three times the State Government may require the University to show cause
within such time which shall not be less than two months, as to -,vIry the University should not
be derecognized. If, upon receipt of the said reply of the University, the State Government is
satisf -ri that prima-facie
case of violation of the provisions of this Act, is made out it may
deiecognize the University by a notification published in the Official Gazette
with prior
approval of the University Grants Commission.
(7) During the period of. the management of the University under sub-section (6)
the State Government may utilize. the permanent endowment fund, the genera fund or the
development fund for the purpose of the management of the affairs of the University, if the
funds of the University are not sufficient to meet the requisite expenditure of the University,
the State Government may dispose off the assets or the properties of the University to meet
the said expenses. .
(8) Every notification under sub-section (6), shall be laid before both Houses of the
State Legislature before implementation.
The State Government may issue such directions from time to time to
University on policy matters not inconsistent with the provisions of this Act as it may deem
necessary. Such directions shall be complied with by the University failing which the State
Government may take a reasoned action against the University.
All assetand properties including permanent endowment fund, general fund or
any ottlerr,,fund also the liabilities of the University will belong to the Trust in case of
: .,e:"
dissolution of the University under any clause mentioned herein above in the Act.
t
co i
(1) The State Government may for the purpose of removing any difficulties,
particularly in relation to the transition from the provisions of the Uttar Pradesh State
Universities Act. 1973 to the provisions of this Act, direct that the provisions of this Act shall
during such period as may be specified in the order, have effect subject to such adaptations,
whether by way of modification. addition or omission as it may deem necessary or expedient:
Provided that no such order shall be made after two years from the date of
commencement of this Act.
Every order made under sub-section (1) shall be laid before both Houses of State
Legislature as soon as may be after it is made.
No order made under sub-section (1) shall be called in question in any court on
the ground that no difficulty as is referred to in that sub-section existed or was required to be
removed.

28
Power ol'tht:
Stall:
Government to
issue directions
on policy matters
Status of Assets’
Liabilities~ on
dissolution’ de-
recognition
Power to remove
drttrculties
am who stow m , 24 Gift, 2015
(2) lf. upon receipt of the reply of the University to the notice given under sub-
section (1), the State Government is satisfied that a prima-fucie case of mismanagement or
violation of the provisions of this Act in the functioning of the University is made out, it shall
order such enquiry as it deems necessary.
(3) For the purpose of an inquiry under sub-section (2). the State Government shall
by notification. appoint an officer or authority as the enquiring authority to enquire into the
allegations of violation of the provisions of this Act. -
(4) Every inquiring authority appointed-under sub—section (3) shall while perfomiing
its functions under this Act have all the powers of Civil Court under the Code if Civil
Procedure. 1908 trying a suit and in particular in respect of the following matters, namely:-
ta) summoning and enforcing the attendance of any witness and examining
him on oath:
(b) requiring the discovery and production of any document;
(c) requisitioning any public record or copy thereof from any office:
(d) receiving evidence on affidavits: and
(e) any other matter which may be prescribed.
(5) If. upon receipt of the inquiry report. the State Government is satisfied that the
University has violated any provisions of this Ace it shall direct the University to make
necessary improvement and suggest for proper implementation of the provisions of this Act.
(6) lf'it is observed that the University is violating the provisions of this Act
continuously for three times the State Government may require the University to show cause
within such time which shall not be less than two months, as to :t'hy the University should not
be derecognized. If, upon receipt of the said reply of the University, the State Government is
satisf 'd that prima-fncie case of violation of the provisions of this Act, is made out it may
deiecognim the University by a notification published in the Official Gazette with prior
approval of the University Grants Commission. '
(7) During the period of the management of the University under sub-section (6)
the State Government may utilizerithe permanent endowment fund, the general fund or the
development fund for the purpose of the management of the affairs of the University, if the
funds of the University are not'sufficient to meet the requisite expenditure of the University,
the State Government may dispose off the assets or the properties of the University to meet
the said expenses. _
' (8) Every notification under subsection (6), shall be laid before both Houses of the
State Legislature before implementation I
Sl, The State Govemment may issue such directions from time to time to
University on policy matters not inconsistent with the provisions of this Act as it may deem
necessary. Such directions shall be complied with by the University. failing which the State
Government may take a reasoned action against the University.
652. All assetgand properties including permanent endowment fund. general fund or
any otli‘e‘tighfund also the liabilities of the University m'll belong to the Trust in case of
dissolution of the University under any clause mentioned herein above in the Act.
53. (l) The State Government may for the purpose of removing any difficulties,
panicularly in relation to the transition from the provisions of the Uttar Pradcsh State
Universities Act. l973 to the provisions of this Act. direct that the provisions of this Act shall
during such period as may be specified in the order, have effect subject to such adaptations,
whether by way of modification. addition or omission as it may deem necessary or expedient:
Provided that no such order shall be made after two years from the date of
commencement of this Act.
(2) Every order made under sub-section (1) shall be laid before both Houses of State
Legislature as soon as may be afler it ts made, '
(3) No order made under sub—section (1) shall be called in question in any court on
the ground that no difficulty as is referred to in that sub-section existed or was required to be
removed. "
31,4
it
at
\i.tn Walt affIRTRut ivtd, 24 V 2015 29
STATEMENT OF OBJECTS AND REASONS
With a view to encourage infusion of philanthropic capital in private sector to participate in the
.field of higher education and encourage cdmpetition to attract high quality faculty and students and
continuously enhance quality it has been decided to establish and incorporate a teaching University by the
name of J.S. University. Shikohabad, Firozabad. sponsored by Shri Jagdish Jan Kalyan Educational Trust,
Shikohabad, Firozabad a 'not for profit' Trust registered under the Indian Trust Act,1882 so as to provide
to the students and teachers the necessary atmosphere and facilities thiough proper structuring of courses,
new methods of teaching and learning for the promotion of innovations and integrated development of
personality.
The J.S. University Shikohabad, Firozabad, Uttar Pradesh Bill, 2015 is introduced accordingly.
By order, •
ANIRUDDHA SINGH,
Pramukh Sachiv.
ARrii010410-70M0 246 -25-06-2015-(516)-599 LIFd111-(0“4tVa/3111:63kU) I
.1.11-0V90/100-R01110 6 TITO ibTri1'I-26-06-2015-(517)-500 L1ItPtITIWZI1-(4044/t/31716t1Z) I

I
l
mfimwwwm. 2411a. 2015 29,
STATEMENT OF OBJECTS AND REASONS
With a view to encourage infusion of philanthmpic ca‘pital'in private sector to participate in the
field of higher education and encourage competition to attract high quality faculty and students 'and
continuously enhance quality it has been decided to establish and incorporate a teaching University by the
name of 15‘ University. Shikohabad, Firozabad. sponsored by Shri Jagdish Jan Kalyan Educational Trust,
Shikohabad, Firozabad a ‘not for profit’ Trust registered under the Indian Trust Act,l 882 so as to provide
to the students and teachers the necessary atmosphere and facilities through proper structuring of courses,
new methods of teaching and learning for the promotion of innovations and integrated development of
personality I
The J.S. University Shikohabad, Firezabad, Uttar Pradesh Bill, 20l5 is introduced accordingly.
~ By order, -
._ ANIRUDDHA SINGH,
. _ Pmmukli Sac/tilt
. ‘ fiowoidéto—Qofilo 246 W—ZS—IOG—ZDfi—(S‘IGFSQQ mar—(W /éi / 311W)!
V WWDYLO‘iIo—vofilo 6 mo Earth—is—oe—201s—(s17)—soo with m—(m/a/mw
- 00000001
- 00000002
- 00000003
- 00000004
- 00000005
- 00000006
- 00000007
- 00000008
- 00000009
- 00000010
- 00000011
- 00000012
- 00000013
- 00000014
- 00000015
- 00000016
- 00000017
- 00000018
- 00000019
- 00000020
- 00000021
- 00000022
- 00000023
- 00000024
- 00000025
- 00000026
- 00000027
- 00000028
- 00000029