Rajasthan act 14 of 2017 : The RAJASTHAN RULES (Regulation Fee) ACT-2017

Department
  • Department of Directorate Elementry Education
Ministry
  • Ministry of Andaman and Nicobar Administration

RGR YGI—GS| RAJASTHAN GAZETTE fasrates Extraordinary —

wire werd =| PublishedbyAuthority

ATE 25, WTA WM 1938—Heael 14, 2017 Megha 25, Tuesday, Saka 1938—February 14, 2017

art 4 (71)

Bd—equy (1) WOU UNH Al sFY wea—-“aRal arr aN) fba am ary seat, Bu—faftal sufe ar uftaferar wed gy) ararea are Paar

fret (gu—5) fearT SERTAAT

WAGR, Hal 08, 2017 VIIRESIRA14 Re «flere (RI or. fafa)

sfaFay, 2016 (2016 or afar G14) HY set 19 ERI ved aferat Gr war aed gv wer wor, sud ert Pafatad Fras aartt 8, seta —

1.aeraara afk ore (1) g4 Padi or araworena faery (Ra or foleas) Fras, 2017 2| (2) 4 words AgadGSR e ante 8 waaeh

2. oRams—gafast 4, waaowet 8sree atfaa

4 8l- (6) “aean” 4wore ferea (eraarfafa)

sfifray, 2016 (2016 w afafar w. 14) afrra a: (@) “Weu’ GsaPast8 gears wenoafta2:aly @) “ora” B use war SB aredl wan ae F aeqaaq OeAen Brasift 2|

(2) S41Prot 4ogadfea wafeequfenfta adi fortmagrad sieafraferal orat aef eho aloeafar ¥ waafee farwar 8|

3. AaI-facl-sranewin OS dowdafedaeafae uipar— (1) flere etversalar afsarafffra atarr 4 @) SI-IRI (1) & seisaise area—fto—searoe TA wTsrezer erm |areasTEoT aftaflercaa ae afi seam er wtfaerre & vera ayaarerraaa fearoreeT | ( @) HaI-fa—sear STH ST seme HTH AY dow gor] weg aa—a-seaeWH oS GH Weel B, weq-1 ¥ don Uwaefeaodaleeantee

WI? TOW—1T5! RAJASTHAN GAZETTE W Extraordinary ' mam WSW 1 wEfisficd‘Eyflutfion'ty War 25, 111131211? 303% 1938—m 1.4, 2017 Mag/1a 25, Tuesflzy, Sal'ga 1938—Februmj' 14, 2017 mu 4 (VI) all—Eva (I) 21621 mam E1941 3R1 lm—uflfiqnfiu) am am (2531 "F51 (mam: 311821), 3114010211 31le a?! llfmfz‘m am) EN) 6131141 21317151) filml firm (an—5) fiwm ' 319W W, waft 00, 2017 mwmmm 2416mm W (115m 251 0 fifilma) sfiafilm, 2016 (2016 FM 31101912111 WI. 14) 3% am 19 gm Ema ‘afifilfi W Wm chm “g? {Nu mm, web W W film 21:11:11 3 3121):; :- LWWFTHSMWI— (figwfilm‘flmmllmwm Emma (tfill Em fifilzlm) film 2017 *3! (2)3?Wfimmmafiafiallu’fi8ml 2. Wesfifimfifimmmfifimmm Hm,— . (as) ”WW"Y§WWW(W$TW) sflfifilm, 2016 (2016 EB? sfififilm lit. 14) afifim ‘5‘,- (GI) "m"fig¢1fiafififiw¢1mafifia§sifi (7T) “W'WEfUB—ofilfimllam 'afimalsfiawlm meafififi’a‘l (asvflwm—gaammmmmwmmm sfilafiwfifilfimafiafimmfiafifimfim WW?! 3.maT—fim—31wmalilmafifilfilimamléfim um.—(1)fia1ma€ruammfimgfiamarfifimafiam4 law—am (1)l%312fifinféfiHmT—fim—31WWWSI€§H WIW—m—WWWWWWWW ammfihfiamlfimmgmmwfifie fifmrmlilm ‘ ‘ (2) W—fifiT—W W 251 3192181 Wm 36‘) @1833 WI vllfircr W—fim—Wmmzfiwvallfiafi,W—1fi, mammgmmml

18302) ROTA Wy, Rae 14,20174(71)

(3) AWfea 4 dom or wa, wa3k orksiafde arf feaaci—fla-seaeWr GewapTew w whAe3 amefearoremoR arar—ftcr—seargeSTAaTsteuet ofr wast dk flarea & feaas oy veaftlafear arom) as uae mat 4 A)oRenfera fear ure sikfaenrau a) arase ww Wfsetsfearorm, afeowl WAyfaasree at) (4) dow A womff weal ot Ea een ow ca vfeert evh, rorges a aria %, seuer and ave & fare dow vera wn ike afe wereft sé atl & at dew woftaay &ura otk wae feaward gt:gard orn |

(5) Weale dom oH sewers seaer gRe sik Taal srquRefa F suRed weetertvadda 4 8 qa 7a Hhonta after ea ay arent | (6) arat—faci-seaa wr or ufaa Jon HY ara B wee fea &WRGigadar gen) ergafaerca &afeaas ux weafd uret sik faeray HYdase weacts Pra ore, afe waa weil gfae wumar et) domGS wriga a ule

él, See Sears ae A | , 4. ar—ftr-seanedH GS odaskGa-WH PrafaRad adel a fidea aik Prafated eat wl Ue SM, seatq —

(i) fderea=a oreuflfaerr verfafaaPreror wre, safe wrt sik urgamdaxafafaeat &fae ore b ay aaawenyure wear.

(ii) eeee

eee HlGeradBAT: siz

(iv) Weaptae wfafaeat wtsnaguparsit ar eter OAT|

5. farce «eta ore wafa @raea— (1) meats YTGS tod GB ea a PB lax faeraa wee osaft@ ret otuth Sae Afaerag Hgel wa 4ame warfear aren) fferra=a oraufafa & Tet @ foe Wee otwa fea 8 wa a a am aa—fdi-seae WT S velo Weerw wR MA Aala fea arenGelare—ftarseargeeraor aiegeref wast

1§_3_(2)_w 7777737777 7777—7737, 777777 1413017 _ “W460 (3) 7771777 77 7877 77 777777, 777777 3777 7577771777 377777777 7777777 777%77777a7—fi757—37w7775777m7777a7777777777777fi7777777 WWWWW—m—WWWSWHW 777773fi7-ffi77m7577777777éq77777hf7577777n77n777 W 757777777777777777777777757777772777737777777777777 777177777537 t7777737777~777f$77777727777 7777*7777‘777777737‘7777W377 ()767577777777777777777857757777777377779777777777717 7777777777 777 377777 7‘7 (5781187 377777 8778* 75 $77 777775 72777777 77777 3777 fiqufifisfififififimwfifimamfiflmm 7717777777777§r7 37777777777717! (5) 7777777 77675 7757 3777773777 37577777 77777 3777 7777757 373777777? 7‘7 mfimfimmmzfiafifigfinfimfiafiwfim 77677777177 (6) 777777-fd777—3772777777 777777 $7 77f7777 777775 757 77777777 7‘7 777% 77177777777757777a777777757777757777777777m77777r77777‘ 7797777af7527777777737777€7€7mua$7€77777576773777777fi5fi 3777777, 777% 777777 7777 73777777 77776777 7777 787575 757777777 757 7,7777 WWQIWWWWWW,WWW ‘é7,377777aw77777777777fi7 4 777777—77777—3777777777777773‘3fim3777757777 777777 WWWWWWWfiW 7577773727777:— (i) mwmmmumfiflfiafifi‘m7 777777 37777777fi7737777767775757777771fi©77775fi77 7%777777777757m757777777m; (ii) 7777777777737757776777577757777777775777’772707 (iii)37777767777776777777fi7€77777%7777777777777377fi7777777 77%7777777777777377 (iv)7777zufl77777777777fi77777€73777777775a7377757777777777 - 707777 5.177777777767777757777777777777777877.— (1) 777777—77777—379777777 777775 777-37 75 7:77 f777 777 777777, W 77777777377777flfa$wafiafi77737777577777777777a777$79€7c5 mmfiwmmmm7fiwwflaqfi777fifi$ 77677777777777‘77377,~77777777fi777775777577§777777 77777—77777—372277775777777771772777777777777777777777a777777 .WWWW—ffim—aWWwamafififim

wT 4(1) GRU Woy, wat14,2017 183(3) aRfaery &Aes as uyvetsfarwT | Gewel Heir

qo aRafea fee orp ate foerea a arage we + suesfear orn, ufe oy of yfaerwaerereT | 2) sraga, arettParc o& feyPadatta 8 gd gage yiat—fUer O fakaa 4 ur amrraga, ufe wi yfaen sree 2, srifsafeed arr | (3) wet srdeat AG urgfess wo G (Randomly) atexl frareft GRAY | doa or, vst are PorchmA & Akargreg ward after ot cReafea four urn sik farsa eRe wre uit @ Weal Hedi @ wer defer fore fretaffrontat srfva ferar oer |

6. faenctaeReGreaft @ adar sik aea—fae

urert weft, sat — (6) wefan cik ages aa mea Protmsual &

SPC HI ATAHA GRA, (@) afafaa er sme et va-rt (@) 4 fafifte

wa @ Wary wa Ssary S War A vag S Wid weataloxfafazagycar: dix

(7) asta ore faframa ufafa a, aemerfe, gate was a Getwa ERt atic wget almf z, HALAS GAA SITS HIT|

7. faeroaetaorsatta a goe.— (1) frees eat we ufafa ar sea faerra weita oraufAfa. a aoa garam | af orufeaoec—-2 4 flereaenaoreaffa & weet Fldonorafeyontwen) afewdom a ante oasesfea ad orlfear area | .2) afea flaraa eraorywfa 3 vale wae a Yorgad Steert totwer afetsrget SB uReafear rear | afer BYaifechepfer yaoaf w spranatey fee ufketer wal ore | (3) ffareraeta ora ufa at dow F ae arf aaawae fea Gren wadefearwee sued 4ef fond a on S oy a faery =e ora afafe & weesararftarer) afe wort saatett &, a feercraenaoraafafear steaer dom ol waht Gen)wit dow, sadom @ oil afta aiafeff, o} ona 8oefa deaor @cea gs: garg are)

EL_EEBEEEEEEEE% cw? EEEEEEEE_EEV€ EEEEEEEEMEEE: E_EEIEEEEEEE¢E WEWE EEWWEEEKWMEBWMEEE EEEEEEENEEEEEE: _EE EEEEEEEEEEEE E.EEEEEBEEEEE EEEEEEEHWEEEQY _EEEE%EE EEEEEfiEEEEEEWE EEEEEETEEEE_EE EEEEEEEEEEE EEELEEEEEEEN :EEEEWWNE NEEEBEEEEEE EE Egg .5. E Ea E E E EWEEEEEE ”VEEEEEEEEEE EiagzgfiwfiwEE E . c515. Ffiwfim ENE EEEEEEEEEEE E Infiwsfihflwgu EEEEEEEEEE ELEEE%&%EEE¢ _Ehc.5=~&m£€w EEEQEEWEEEEEEEEEE War Ev? nwmmfl wt» CE 5mm WE an EEIEE EEEMEEEEVEEEEEPEE E E 22.35% a E E w a E» E 5 *EEEE m 5% EV cub ME .wwmficw E a ENE an EEIEE EEFVEEEEEEE.EZNV figfigwagwfimflweggflmg an E Eva aw E g» FEB Sfi Ewficu 6 m EEE_EEEEEEEEE E m m: tam 3 «5,155 E355 531% RE . E

183(4) UTRATT_ UIGT—-7y,_ HA 14, 2017 AT14(71)

(4) faerctaEMaoreafl wraaddom a1arigadur Hm sie ot dow a aka waefea-h Alay, Ward aw atloRafeaGe| (5) dom or origafore Rien aftert a daffa sofia al, wa oflsafaef, Soeel Gara wT| (6) fe alg weerari—fter cera dim aoa 4 arqaRera wea 8, a Seal Mewar Mae wasitGTeA sie Wet RetPeat ss se oe vleftie ad@fav war andeat AG ced err 3) arent|

8. shay otarr 6 @ aim asta orefafa aria otwendRekaaasik detawre fahrame@ afAfa aRyma aff & ara ante wget aetatufar— (1) fara yt Wael, aie Seiftre afG uy GB wa S HHwe ard yd, faery etawre aff a wmec-3 4 wreora Wet PAT | (2) ai& faenaa vata ore wi afer atare wt

wo-unt (3) 4farifdss awremaa &verore-farRadae 4 spa Yel &, dl ude oflFaa SIaR 6 H wa-aRi (3) 4 fafafese aremat #aaa & dwfa & tre wta Gu fara uate a sabfaheag &fa faenca waite Orr ara ot oeqafetwa waaS ae, Aaa wRag—4 A cepre Freitas Heat |

@) varfderca vataoraufafa &fafeaa &fee flerag erigore uffa &fafasca atarnka 8 30 fea &@ aa WIS AateGe WaT|

(4) stear Peer 4 asa wre fata afa&fares a afdwar aflare Enteoreaft, tS faAeas a avra Udkfest &Haz, vararrwegafed7aora } gear six faeryera oraufafesie audeora faa aa d farizayat ofa &ee,gate affa& eae weo—6 FH adla OY Gay|

9. Gs orefahame uffe skger ufifa a ResWe & doowd fotflerad } vfaeai axUsa wrefafranewifeatk gaterr uftfe A amPite maf @ vfafaat er wi dowwa deafea urht oe IAT GR RTH ART rerfafa Far ret

19314L W , WW mafia. W 14. 291 WW) WWWUWWWWWWWW Wmfiqwaam 21%} a‘rfiafimfiH-$1fimmmfii afiqfimfimml (QWGHWfi—cnfémsmmmWW—fiéfim afi'iamfiamférfifimwmml (afifiéWW—fiwmfiwmnaqwfiqawn fiafiamfimmw‘avwfimfimfiififlfififfimsm 31%“? game}; Na) TEN gird maa waft gm 3N1 firinfil e.mfimfiws$afiaz§izfiumfifiw Wafimfiéfimmfiafiimfiumfifimmfi mwmm$mmmmafim.— (1) mafiufiqamfiamaézfimfimqfimm W13 fimrfi‘mmvfififfifiW—sfimmw WWW! (2)21fi’ffiwaadafiaqfivfifififiamwafiamew w—arrr \ (3)fififlfifizmmffi$wfimqfivfafirfiaamn qu‘cfi%mgdasmflwafiameafiw—m (3)111 WW$W$WRW$W Wtfiv WWW,WWW$WWWQW am am 931a an: TR} WW 3% W21, W Emir—4 1‘? 6763318 WWW: (3)mafiamwfiummfifir$fifima§fiwfimau Wqfivmfifia§firfimafiafiafi30fifizfiafim ‘W—sfimmml (4)Wm%fim%fifimvfifi$fifimfi mamamfiammuqfivafififififimfiafim fimfifiifififimm-mufiafifinfim$wsfiq Wmmmfimwmfifiwma: Wafiufir$wq WWWEfiWHW—Gfim ‘WWfiI .9. mmmmmmm$ fiw—WWHEWWrfiGfiW66W SfiYWWWWWWWWfiW W—fimzfiwfififimafififimnfimfififlamfififi W—memmfififimfiafiml

art 4 (7) WRI Wi-Ta, BART 14, 2017 183(5)

10. a }sae &far sftRarore— afar a art8¥ faite oral & afaRar wra a fafagag wea waePrafeftedareet wy ftarfe aren, seta—

(i). g-71dta @ selsfleraqa artsoe gear wi grand sinkt ecaay okt divedar yfaany,

(i) writ a dem. (iii) BT ei sues oral ah ara yfaene oh

Rone, Ysa, enrtarch, deans sik udurie weit a wer seule:

(iv) wrt ot yeael, svara gRaeisit geaf& er vers aieoreer wear) wef)area seferp ara:

(v) wor a Steg & vue, six (vi) feraaeReore aff @ wer veer aR weqel

fear war arg sea SRS| 11,Seerate ot gigs er sare = (1) were Frot

(@) °DARE WAL oa cote we UIST ager,uredfactawera,ataRe<wr daa} Ware,AAsikBoE, warren altasik VTE, GREY yam, aura, greyey, WeenG wy se ary soa aa &fay yaw

cat. GeanRa Se, (@) fore, seal afte akrerat of oad faenara GRE@veewan am @ fee&fav wi GdVAT We wueralGre oT Ua: sik

(7) «fafi=t sel a oftral aie ae 4 daawae TsR & ue, veka wea aaawoR wer wa aefecasi m date ware aetmi & ai smety, as wigSort Taet, aRMBHRG 7 we fea my ey

(2) weefofflares,scan(1) ¥fegeilaie afteral & after, Pratt a denawen,safe —

(6) earery xfer (a) vast xfer.

(1) wR wae:

(3) whe Barer eferex. (Ss) (Was ae.

(a) GeTHrery Se sea Hat SAT:

17717 4 (77) 7777777777me W677 14, 2017 183(5) ’ 1o.W$W$W&fififiW.—a®fiwafi $777787 fififéwmwafifisafimawfivmfifimum WWWWWRWW.3727777:— (i)- é—Wzfimffiamgmmmw 737712777 37% 372577777 377 77772777 777777777,- (77) 57377 2177 m,- (170877377 757 27777727 $777777 77777 am 71772777 6777 7 7777777727, 732777777, 7772779777677 W 3777 777277777775 77777 797 273777 75227773,- (iv) 85737 7737 $727777, 37777777 W377 $727777: 657 7777727 Wmmpfi 7773277787772777177, (v) 777777 177 7777777 777 277727,- 3777 (vi) 7727777277777277777777777777777777777777127 @6777 W 7773‘ 377.7 777$! 11. mmmmmfiam— (0772772577777 H-w.,WM--—u- (€57 7773727977777772a77777®77727737277777§77727 WWWWWfifim$ 77271777777377 m7, 7777777772777777‘E7373777 2777777 377727777777 177277; mew—77717177 2572727 7777277777777 3777 3777707727 71727277777717ch WWWHWH; (77) 77777277 W377 377 7 3777757797 717 277777 77777377: 777277777777777777 21772737777777L‘7U777fi‘77 77777 Wwwwmmmfimwflia‘fi (77) WWfimmWemmfifidfifiW W$wa,2wfiaa7@fiaa$qfi7®a7é7n' mwfimfiafifiufimmmfifiimfia 3773778777777777773‘26777777773777777777‘772777757 777277777877 (2)7277573771777272777 377—777777(1)77777777772@77§73773777 377777777$a7fifimfit7fi77®77¢7777€7777afin27ufir~ (as ) 77717727 7777727 (27) 377727 77777727,- (W) U37?! 7177?; (£7) 177777 77717707 7777727,- . (8") 7772 37—67 (7) 372mm 377 37227777 252.7 377577,-

183(6) _ SRA WoI—-TH, HA) 14, 2017 arrT4 (71)

(3) ohare suRertt wre ak arakRg aay Ufo;

@) era oaRefa vforer:

(31) . asa BIge; (1) ahBRS.

() aaa farear; (6) ete xforex; (S) WAAR WATTS ORT; (s) Wer ora der wie: (1) sn@Raact aa xforer;

\ sR xfareew: oi (1) | Naa feberar xforRee|

(3) wel Prof) lerery, BREE SRT WRIST uy one anevit S STIR Ga S sey stronaayPenaBea |

eat

(Fray 3@) faq] ari—fici—srearme TA eI dom @ fa afea

cconsannecs fives ecrage nid SG.DB (aera wT ATA)

Sar, BAY TAcccccccccccssscccsssscessnseesecesseseeeeen

fava : arn—ftr—sieromwaaldow Hfay area|

Aeley/ABleaM, sade ofa fasa & wel a wore fares (RI oT

fafiaas)aff, 2016 (2016arafarS14) Hae4 aH BI-ERI (2) 6ws (S) sikwore flares Graorfafa) I “Fras, 2017 &fas 3(2) &sadelSaspere, srer—fla—searsas i STABTSODcccccssseenee(eae) Pw.(FAA) acc Hi are Qa) oxfaaat we By i

don o oRiga sas wea Pan 8) sag Iow A waa wT wakes Bt orayefearcra FI Waly,

ufed

Ara-foar—siearge SATA foes rt AMA:

.m LEE LEE 2%me 5 firm 5&5 LL E¢EE$EE§EE€BE E “m E»: AEN E g AEHWu/Iv ........................ ............... AEV.1:”...123111.1.2? AEV.....2Z.32................M~Namw .fiul E Ewtglfiw Lama mm 5% aw A Nvm 5% an tom ELL. Agfigvggvfifivgfifi E515 Em v 95% e; W Kg 5 98v Sow .Efiflfi Agvafi 5 E3 E5 ELEV w LEV Mm EL 5%. ENE .Evrmr\wfimb Eatuvfi figfigggxfifllfifi N NE , :3. i" MAMA hf“ " .g E EA BEEF/[£155 .................................................... %¢%\% .EEV firm. . .Lw AVE”. E ~ _m n C ........................................................... FELL“ E w E aw ELw ggtfir 3% Em Emma VIE _E%§mwmfizm EmmwfiEE 6. 55% $5 g gig Em EE Ema at .3»; 5 .szfiw. E& E: 3 £8 E», Eats Ev WE Em E E E? LE 5% Eb E WE WERE Etna E E E E Ba E @ WE fiw. E Emma E . E 9.95? gag Em AE .595? Egfizwgggg E Ema"; MEN .3 5wa Nut; wgg :62”?

any4 () WRIWoi—-wa, Weal 14, 2017 183(7)

weq—2 [Fra 7(1) efeag]

fterea eta ore ufffa at dow @ fort afta pes rene pevieirestenerussiearsnstntal (fferea aT aA)

u. feare :

ST / DTMccccccccccesseneseneneeesenesenese fdarera Fag is aay al US,

fasa : fereaeraoraaff atdow &fru afeu|

AeleY/ASlea, waged afi fava&wef 4 wore faerera Graa

fears) afar, 2016 (2016 or afar UW 14) SH are 4(2)(8) 3k worm feera (ra or fafara) Fae, 2017 & Fay 74) @suael @se, flares S wae SG Grawaa aw foar faster @feysik wa oewafea faheas aA &fay

cocoseetnseettsteee faearera otara) a faercra= oreafffa ay TOO cc ccccsseeceensseeneee (FEAT) BTccna(AA) a ceecccccsccceeeneeee (er) ax Fad at weal S|

waaly,

afer

ee [Pat 8(1) eRag]

amr 6(2) @aniaflere etawherBAR wtantfteBaoA elBa olWea

wary, cieshttrsseurianeguequnsdiocensesvn(ders or ara) @ flereraEla Ore Be

fase: afr af ®fayGRAGaalGTWea|

Feled/HeeaT Ehecearoretatieavealoe (era GrAM) GTyar ay Waog

. ......................... W II II!@ M .................................... III I ......... m km ELISE. J92 (ME 192 I I} '3] I) ............................ mafia/ragga [911225 15:9 H bk.” high big {E ................ m @- . rib-g %m high [213m U‘IQIEE! QR (hit 15E )............. .......................... mammal M wmmwwmwmwemm [mmehkg] E—M lg 13m gag 2mg Ah (mm) ............................. (mama ( $1153) fl: Isa W Lush RM #2 (m1: & } ...................... halifltkSBEé-thhkhfiwwéflwlfihwm mmmw$nm$M'M$mmwmhw g; uoz mag (mm 132 ma) Rama; mam}. iii? (13)(Z)t7 mm g9 (m IR ways 192 gm) QLOZ htdgfififi (gauge; mm) magm'gwcgmwmmzfim 'mgau/mlgm I}%¢w$mwwmwmzm mm Lap, grga kthh mm taking .................................................... WWW‘ ZED—Ital a (Id-LE Q I “I El I) ........................................................... WMQlQQPeLfiEWWWM [MER— (01 ma] Z—m (gem uoz 'vL gm'fifilm mmum (1;) v mt:

g3(8) s“<s§$sWRIA aa-35, WANT 14, 2017 ara)

ay wha daa saftaae & foras ate Ara fed wa

sare at drasd) GT ATA : faareaa @T ATA : . ysl ag Tag a: as @a @aLrat. ar Garfsat. a sry): Heady:

BETcccDicesecscsensenteesqe: UAE/sr hy GAT: wrt ay Ween: wera waar wre:

j —

g L

|

O R N A A R Y W N

= oy

w|war] warat al | wenida | ame| we gea | araftaai |, a. wrt WRI (4-3) yfasra

(1) @] & | (4) (5) (6) (7)

fea : FeaR GRIT G aR] aad,

ufera POSTTEST ATA caccccccccccccceccsssscsssseceessecnssseseeetteen ura Ul asd) HT AM :

feat :

fdereaapTAa:

WeI-4 [Pra a(2) dRag]

art 6(4) @seitadawrefahameaff arsae faisag @feryfréer

{33(8) __ EWIW—qa, W 14, 2917 {1313(3) . dQ w‘fm Gm W.m%mafififlfi R13 711‘: mm in mm W W : mama 2m 71TH : ‘ a; (a an: m § 11'. : are? 2m 7m (wmfirm. In 23mm. at am) : WEI-TH 1 WHY ........................ 1’4? ........................ a??? : wmfi/arjwfi fi Van: 8513? a?! van : ‘ 258mm mafia q‘fim : ‘..A 13L t “DPOF‘QFJ‘9WNf‘O‘Wr. '95.— aitar 1m an? a)“: NEW W Ifm $3; an wgf'éfiuf ’ 11‘. m m (4—3) ufiiera [ (1) if??? .(3) . <4) (5) $6? (7) €41th : Ira—en? @5111 $ 381?! WW, ERIE: WWW: ...................................................... am In firmgé} Em Hm : ........................................ W '65 : umraIfi/WW WWW: .............. ~. ................... _ WHTWEHIW: ........................................ afisfiqfi man—4 [fiandzfifiaé] wsammmmmmfimfifim afifiwfié‘w

art4(1) WRIA WaT, WRAY 14, 2017 183(9)

- Ofeet, yea Weea—ufea, ada wre fara afte,

“Bam 60)© anitwie Seer orRes)

Hey/ ASTEaT, ccossssestenseennnnaneeneeee (FASTA BT ATA)ce WOT

A ATA GBC FacesFOTO cccccccccssecsseseeeeeart Slefera GN cc ccesssescnecetseennee& for oe Wan o aT Sa wT fafrzagfer &fraseaRArafed wa s —

ee eee eA

oraa) a faerera elawre afffa er segafearvar al quite flercra eRewre afifa 4 weara oe SUHTayaa UT srgfecrat waft wel BTS, st (faeces aI ATA) aTvar oTUra & da 4ayfadfaery onifedaA orsub Entfadeserat 8) veafdaGra raat @AR sik suefey uniree yaa cera G werwa BI

1. araatakasdla ar: 2. fda orar:

3 Oslag wag a: 4. as or ver wafer. a @arral. a aq) : 5. WyearArea : 6. ETac cescceceseenneec: qe 7. Wart/agarGlwear 8. BiaGYGear: 9. ad HA aa

wo. | ea | vaavot| uenfaa| sma|ote gfear| srafeaai a ORI ort (4-3) ufersra

(1) | @) (3) (4) (5) 6) (7)

.

..\ (A) (9) (9) (V) (‘6) (Z) (l) W (94') Edsb Rt?! a Waafiw- Hate 2am gnaw: m In ILEEALLRLghMRleQ 216$wa rmwyuhfiR/umm rm ........................ kt ........................ mm :hmmmamgfite : (12:19 m 1121;4th m 'gnz‘lgmh.) M 122 g): I'Lhéahéiuuah :mmnmrag :hmmemm Iggfimmmgpmmmgé Mmmmggmg WW$MWEEJMM§MB2€QMWE wwmnfimwfiflwmszmmmm (bu: L42 mag) """""""""""""" me E- Lsxa 4&1: mam megficw mmmegWMWMW£ Immmgfibhgwmmmmmggemgue Mag) .......................................... wlfi .............................. QIQ We $W$(L)8mw&mflw$mw - *%@@%§®M§MMQ mewflmww$ ...................................... M WEI”— ........................... 91.1%! ............................. B- hiwhgmeg M QB ................................ (hm 152 1 El 2 I I) ................................... ’mpggh / new; v—‘N‘m'v'm'co'rx'oo'oi Imggmmmgghhumgwmw ' E ......................................... 'W Mme; Mb mfil Egg—M high 'W ' (6)28; uoz 'm gm 'Eh—m mama (1157;1th

183(10) XRWAT,RANT14,2017, Ta(1)

wadyy,

wife FORT GBT TA cocccccccecsssssevessessesseseessssmesessensevesen FORT UT GRATISEY GBT ATT accccccccscsssesssssscceccnsacceseseeee PRATER © ooo ccccscceecliceonntlespotrsmsiezarse

Qararary ur yeararearae

FASTA BT APT ccocccccccccccssseeseeeseen FORA UT GRASSY BT AT hace ccccccccccccccccesessanesssseeee al ar a faarau elu ora afafa wr ufe

wreg—5

[Pra 8(@) <fay] wad ore ferme afafa ar ada

WN :

FORT HT AT haeccccceccccccccccccecceeceeseeeseee WET oiecdeescaconeanoninmcencn POTD ecco ccceccescccsssstsseeee

afi. aeq Wew-ufedg, wera ora faharma afafa,

evn; racnnanrteseugraneanneessWVS|

fava:werentfearera (eraorfafraaa)Fras, 2017& fa4. 83) 6ofawe Wer @ yer ay are|

Alay/Areal

veneer tepersteunn (FASTA BL ATA)ccc WET A SOA PROT Gocccceee Kets|: ert sleftr ay. ee feyokaeee or Gertawlorfaeces fora &forge ai arafedwa 8 -

wailfe der artwenawha seerok Pereaety okaufafaerrsgaifedt wredear Asae B, BAe ccna (fence otaa) &vader Awakafahear ofae aia

wry-Wm UWOL MW gm __ —m_ _H w W 5% aw CUP—Irv» r m _v ............... ........................... .g m E a _ _ m .m 9%. w __ WWW EM _.._ % Ewfififlggwpgbwflgpfimghflfib .1. m W: E EA.” £8 E m E FVIW.EEEEEEEZ m: £E..MW ................................ . ...... EN Am Em. “ w E W mg g ................................ AEW LB _ _m m_ V ............................... .E\Eww E? ggfifigggfififamgfl wtom. Efgflflggvgg Epfl 6E ......................................... £55. Egg Egg pg .wEWIE Eb ..%% bra gfiggflgwfiw AKWEAMEEA mlE Eu raw flaw Fan HE prune @Ewfi ........................................ ”FEEAwmcfiWS.L .................................. H Ev E GWEN. 5:5.qu 5 35.5.55 ............................................ H SHE ........................................ u E KW g “I“ AU. $2M ...................................................... H E... 5 game EpaE HEN: EVEN Mamufl $55,..mmhmhwfawfifi.. . 2-8;?

wet 4(1) GRITWT, RANT 14, 2017 183(11)

ve é| wenfaa wR dear & aR ak sae fer =eaifaca Ua CTI GS Me wea B -

1. Ura Ur Gage)wT A: 2. fdeneay or ara: 3 gam wee:

4. as wary Qa. a GarLral. ar ary) ; 5. MACE HT AEH- a: | Tassescssssensestnstnae: 7. WAP/ sq ay ea: 8. Bral O Bean : 9 wala WR Ueda :

we.)wer) date | wenfat [ora | othe gfe or|srafeea | a. wR | whe | (4-3) afer

Oa) 81 @ 6 6) @) | fo | L Harare,

wife

yararars_ / veararegraa PUSNAD BT ATA cece (art a arargel wr ary) :

> YRd-6

[fFraa 8(4) eRay] afer @t at 6(7) &attger afffaarsre

UNG :

flerea Tare:

..................................... shahlsiat: E} ' 9316 wgwmmhfihmaamsmgmwm [Assumms Q—m - 1?ng ........................................ 2(hih1921;25 hgthlfllilli‘) .................................. I hit 1512 I 12.51% mmlbltafi/ $131535 ........................................ $11th EMLLLRJ:J ..................................................... IthJéQ Fail QEJ'L} 'RQJZH. (A) (9) <s> <v> L491 1} i i w (e—v)‘1 1ng it wide 12 iii: Lush w .313;th £91 1‘33“; “393 ‘9? : 111mg mom may; 3 115m L92 #993 _ : 11161.11 #39 gummy gums ; gm; ........................ {g ........................ nag; : mm: 112 mgge ; (my: .112 'lp'lgflh'sp. 1.er 1515mm) an; 192 gage : 1mm fine :3»: E: : nu: 15!: mama; : km: m‘gsma in mm 3 2mm mg g: gammy. 13241;} Wit 5% m we um 5? ”#1 fish BQJHM '% L141 (LDSBL LLOZ 'm 13mg; 12mm}: Tm, ma“ ‘” “’(u)'v,1gm r-‘N’m‘v'm'm'rx'co'm'

183(12) SRT ea, RA 14, 2017, ATCT) ganterer afafe,

fava : wore fterca (haar fafasa) afafras,

2016STat 6(7) sik wore tera(eter ar fara) fran, 2017 & fraq_a(4) @ acta ante

Fey/HVAT, asia Grefara UPAR PacersPOAT.

a PARAS BT cccsesesee(tara or am) a wee / fier eRe ora wf, garteraff&frar&fav SahERI so siaWega wea & al dasflazit ¥ alka ay axarashlwrenartwafla 2:

. TOR a ahearsdloraA: faerya ATA: gsagwaga: aS OT AA (rarRat. at GATLRLAT. at sry): WY HTAAA: BETcecccccccccececceseseeesGoccccccsss cesseescee ae:

|) OP O N A D R W N3

wm. | wer| waatat| weataa | ame whe df ar| aryfear a. wy WRT (4—3) ufagia

(1) | @) (3) (4) 6) 6) 7)

[eat a. a(17) Rens/Bra/ 200401] UIT H arse a,

UR Ula|

1.§§«(12)W _, mam mar—tn, Ema-fl 14, 2017 21mm) WWI mm ‘ fawn : W flaw: ($111 W W) W, mflmws(7).fi W W War fifimfi) E12111, gm? a} flaw 3(4) a} 3125}? am]. Tam/What WU W W W 21 ...... W ................ $ Effie—in: 1% 211% .................................... (Elam 2m 7an) an QW/fivmumuqfiv ma WammEfifififiasfiq Wmamfismwafim’éfifiwfiwfifiwfim sfivwfi—fiwmgmvnfifa %: wmmafim: WWW: Q’QWWSCW: ahé rm Hm (WHIQTEW. m Efimfim‘m m 3731): WEB—Tm: ‘ EfiéfiT ........................... 2% ........................ fi‘cfi: WW/sfiwfifim. Wfim: WWWW; 'SDPONQS-“F-WNE 14. um; 92'??? (4—3) ma 2:61 as. aafiwfiraaéafi mafia 3m? Wifli'm angfiam'_"' (1) (2) (3) (4) ‘ (5) (6) (7) [m tr. 3(17). flaws/m / 20041116] mm a} m a. W HER“

art 4 (ui) — FRU WaT, WKAR 14, 2017 183(13)

EDUCATION (GROUP-5) DEPARTMENT NOTIFICATION

Jaipur, February 8, 2017

G.S.R.114 .-In exercise of the powers conferred by section 19 of the Rajasthan Schools (Regulation of Fee) Act, 2016 (Act

No. 14 of 2016), the State Government hereby makes the following

rules, nainely:-

1. Short title and commencement.- (1) These rules may

be called the Rajasthan Schools (Regulation of Fee) Rules. 2017. (2) They shall come into force trom the date of their publication in

the Official Gazette.

Z. Definitions.- (1) In these rules, unless the context

otherwise requires,- (a) “Act” means the Rajasthan Schools (Regulation

of Fee) Act, 2016, (Act No. 14 of 2016);

(b) "Form" means Form appended to these rules: and

(c) “Student” means student studving in first class to twelfth class.

(2) The words and expressions used but not defined in these rules shall have the same meanings as assigned to them in the Act.

3. Procedure for conducting meeting of Parent- Teachers Association.- (1) The Principal or Head cf the School

shall be the Chairperson of the Parent-Teachers Association

constituted under sub-section (1) of section 4 of the Act. The Secretary of the Parent-Teachers Association shall be a Senior

Teacher of the School nominated by the Principal or Head of the School.

(2) The Chairperson of the Parent-Teaciers Association shall call the meeting-of the Association. The Secretary shall issue notice of the meeting in Form-I, -fifteen days in advance, to all members of the Parent-Teachers Association.

(3) The notice shall contain the piace, time and agenda of the

meeting. The notice shall be served on each member of the Parent-

Teachers Association in the manner as the Chairperson of the Parent-Teachers Association thinks fit and shall be displayed on the notice board of the school. It shall also be circulated in each classroom and uploaded on the website of the school, if such facility is available. (4) The quorum for the meeting shall be ten percent of the total strength of members, in absence of quorum, the Chairperson shall adjourn the meeting for half an hour and if quorum is not

17m 4 (7r). __ 21mm tram—us, waft 14, 2017 183(13) EDUCATION (GROUP-5) DEPAR'I‘MEN'I‘ NOTIFICATION Jaipur, February 8, 2017‘ G.S.R.l 14 .-In exercise of the powers conferred by section 19 of the Rajasthan Schools (Regulation of Fee) Act. 2016 (Act No. 14 012010). the State Government hereby makes the folloning rules, namely:— 1. Short title and commencement: (1) These rules may be called the anasthan Schools ( R egulation of FCC) Rules. 2017. (2) They shall come into force from the date of their publication in the Official Gazette. 2. Definitions.- (1) In these rules, unless the context otherwise requires.— (a) “Act” means the Rajasthan Schools (Regulation of Fee) Act, 2016. (Act No. 14 ot‘2016); (b) "Form" means Form appended to these rules: and (c) "Student" means student studying in first class to twelfth class. ‘ (2) The words and expressions used but not defined in these rules shall have the same meanings as assigned to them in the Act. 3. Procedure for conducting meeting of Parent- 'I‘eachers Association.— (1) The Principal or Head of the School shall be the Chairperson of the Parent—Teachers Association constituted under sub-section (1) of section 4 of the Act. The Secretary of the Parent-Teachers Association shall be a Senior Teacher of the School nominated by the Principal or Head ol~ the School. (2) The Chairperson of the Parent—Teachers Association shall call the meetingof the Association. The Secretary shall issue notice 01‘ the meeting in Form—I. fifteen days in advance, to all members of the ParentrTeachers Association. (3) The notice shall contain the place, time and agenda of the meeting. The notice shall be served on each member of the Parent- Teachers Association in the manner as the Chairperson of the Parent—Teachers Association thinks fit and shall be displayed on the notice board of the school. It shall also be circulated in each classroom and uploaded on the website of the school. if such facility is available. , (4) The quorum for the meeting shall be ten percent of the total strength of members, in absence of quorum, the Chairperson shall adjourn the meeting for half an hour and if quorum is not

183(14) MORITA WG-TF,BLA 14, 2017 a4(71)

complete. the meeting shal! be adjourned and shall be recalled after

fifteen days.

(5) Every meeting shall be preside over by the Chairperson and in

his absence. by a Presiding Officer chosen by the members

present amonyst themselves.

(6) The Secretary of the Parent-Teachers Association shall prepare

the minutes of the meeting within fifteen days from the date of ihe

meeting. The minutes shall be displayed on the notice board of the

school and uploaded on the website of the school, if such factlity is

available. The copy of minutes of the meeting shall also be made

available to the District Education Officer concerned and the State

Government. as and when required.

4. Duties and functions of Parent-Teachers Association.-

The Association shall discharge the following duties and perform

the following functions, namely:

(i) ito get informaiion about Tuition fees, Term fees and

fees for co-curricular activities as decided by the School

Level Fee Committee: (ii) to observe completion of syllabus as per the planning:

(ili)to assist school for planning of other co-curricular

activities: and — (iv) to assess the needs of co-curricular activities.

5. Constitution of School Level Fee Committce.- (1)

Within ten days of the constitution of Parent-Teachers Association,

wide publicity about the process of constitution of the School Level Fee Committee shall be given in each class room of the school. The notice, of not less than seven days, for constitution of the School Level Fee Committee served on each member of the

Parent-Teachers Association in the manner as the Chairperson of

the Parent-Teachers Association thinks fit and shall be displayed

on the notice board of the school. It shall also be circulated in each classroon-and uploaded on the website of the school, if such facility is available.

(2) The applications shall be invited from the willing parents in

written or online, if such facility is available, before the date fixed

for draw of lottery. :

(3) A lottery shall be randomly drawn from the applications

received. The detailed minutes of the meeting where iottery has been drawn shall be circulated to all the parents and shall be made

watt-t) ._ www-31awriasi’sfi 14-2017 émttt) complete. the meeting shalt be adjourned and shall be recailed after lifteen da} s. (5) Every meeting shall be preside over bv the Chairperson and in his absence. by a Presiding Officer chosen by the members present amongst themselves. (6) The Secretary of the Parenb'l‘eachcrs Association shall prepare the minutes of the meeting within fifteen days from the date of the meeting. 'l‘he minutes shall be displayed on the notice board of the school and uploaded on the website ofthe school. if such facility is available. The copy of minutes of the meeting shall also be made available to the District Education Officer concerned and the State Government. as and when required. 4. Duties and functions of Parcnt»'l‘eachers Association.- lhe Association shall discharge the following duties and perform the litllouing functions. namelyk (i) to get inlln‘mation about 'l‘uition fees. 'l‘erm fees and fees for co-curricular activities as decided by the School Level ii’ee Committee. (ii) to observe completion of syllabus as per the planning: (iii)to assist scltool for planning of other co-curricular activities: and . (iv) to assess theneeds of co—curricular activities. 5.. Constitution of School Level Fcc Committcc.— (1) Within ten days of the constitution of Parent—Teachers Association. wide publicity about the process of constitution of the School Level Fee Committee shall be given in each class room of the school. The notice. of not less than seven days, for constitution of the Schooi Level Fee Committee served on each member of the Parent-Teacl‘iers Association in the manner as the Chairperson of the Parent—Teachers Association thinks fit and shall be displayed on the notice board of the school. It shall also be circulated in each classroom-and uploaded on the website of the school, if such facility is available. (2) The applications shall be invited from the willing patents in written or online, if such facility is available. before the date fixed for draw of lottery. . (3) A lottery shall be randomly drawn from the applications received. The detailed minutes of the meeting where lottery has been drawn shall be circulated to all the parents and shall be made

APT_4 (1) SORTAWIG, GRA 14, 2017 183(18)

forwarded to the District Education Officer concerned along with the list of members of the School Level Fee Committee.

6. Duties and functions of School Level Fee Committce.-

The School Level Fee Committee shall. in addition to the powers

and functions specified in the Act, discharge the following duties

and perform the following functions, name!y:- ’ (a) to oversee the compliance of the provisions of the Act

and rules made.their under;

(b) to take decision on proposals received — from

Management, icgarding determination of fee within time specified in sub-section (3) of section 6 of the Act:

and (c) to make available necessary documents toe the

Divisional Fee Regulatory Committee or Revision

Committee. as the case may be. where appeul is tiled by the Management

7. Meeting of the School Level Fee Committee.- (1) The

Chairperson of the School Level Fee Committee shall call the meetings of the School Level Fee Committee. The Secretary ofthe committee shall issue notice of meeting to the members of the

School Level Fee Committee in Form-II. The notice shall be issued fifteen days before the date of meeting.

(2)The notice shall be sent to each member of the School Level

Fee Committee by registered post or delivered through any other mode. The acknowledgement of notice shall be preserved for a period of one year.

(3) No business shall be transacted in the meeting of the School

Level Fee Committee unless four members are present out of which at least two shall be the parent members of the School Level”

Fee Committee. If there is no quorum, the Chairperson of the School Level Fee Committee shall adjourn the meeting. The

adjourned meeting shall be recalled again after the lapse of ten

days from the date of the meeting which is adjourned. (4) The Secretary of the School Level Fee Committee shall prepare minutes of the meeting and circulate the same to all the members within fifteen days from the date of the meeting.

(5) The minutes of the meeting shall be made available to the District Education Officer or Deputy Director concerned, as and when required. . (6) Ifa parent member is absent for three consecutive meetings, his membership shall be deemed to be cancelled and such wvacancy

s e c e c a n u n t a r m a n a n a n s c n e m s s e a e i n i n i t s e i t

i 0 3 1 C e r e s ,

mil?! l‘ll “Eli'r‘llilntliilffil.FRQ’QJ‘R 2,017 1.8305) forwarded to the District Education ()l‘ticer concerned along with the list ol‘ members ol’ the School Level liee Committee. 6. Duties and functions of School Level Fee Committee.- The School Level lice Committee shall. in addition to the powers and functions specified in the ;\ct. discharge the following duties and perform the lollowing functions, namely:~ « (a) to oversee the compliance of the provisions of the Act and rules madetheir under; (b) to take decision on proposals received from hilaritagentent. regarding determination ol‘ fee xitllin time specified in sub-section (3) of section 6 ofthe Act: and (e) to make atailnhle necessary documents to the Divisional Fee Regulator) Committee or Revision Committee. as the case may be. “here appeal is tiled by the .\l;mugcmcnt 7. Meeting of the School Level Fee Committee.- (I) The Chairperson ol‘ the School Level Fee Committee shall call the meetings ol‘ the School Level Fee Committee. The Secretary ol'the committee shall issue notice ot‘ meeting to the members of the School l.e\‘el Fee Committee in Form-ll. The notice shall be issued lil‘teen days before the date ol‘ meeting. (3)The notice shall be sent to each member of the School Level Fee Committee by registered post or delivered through any other mode. The acknmvlct’lgement of notice shall be preserved for a period ot‘one year. (3) No business shall be transacted in the meeting of the School Level Fee Committee unless four members are present out of nhich at least two shall be the parent members of the School Level". Fee Committee. If there is no quorum. the Chairperson of the School Level Fee Committee shall adjourn the meeting. l he adjourned meeting shall be recalled again after the lapse often days from the date of the meeting which is adjourned. (4) The Secretary of the School Level Fee Committee shall prepare minutes of the meeting and circulate the same to all the members within fifteen days from the date of the meeting. (5) The minutes of the meeting shall be made available to the District Education Officer or Deputy Director concerned, as and When required. ' (6) If a parent member is absent for three consecutive meetings, his membership shall be deemed to be cancelled and such ‘vacancy we». MM.» Aw_i.tme

183(16) WAT WaT,KANT14, 2017, aTT4(7)

shall be filled in by lottery, from amongst the applications received

for that academic year under rule 5. 8. Procedure to refer proposal to Divisional Fee

Regulatory Committee and to file appeal before Divisional Fee Regulatory Committee and Revision Committee under section

6 of the Act.- (1) The Management of the school shall submit fee

proposal! to the School Level Fee Committee at least six months

before the commencement of the next academic year in Form-llL. (2) If the School Level Fee Committee fails to decide the fees

within the period specified in sub-section (3) of section 6 of the

Act, the management shall immediately refer the matter in Form- IV. along-with the proposa! submitted to the School Level Fee

Committee, to the Divisional Fee Regulatory Comunittee, within

thirty days of expiry of the period specified in sub-section (3) of

section 6 of the Act. for its decision. (3) The management may prefer an appeal in Formn-V against the decision of the School Level Fee Coinmittee within 30 days from the date of decision of the School Level Fee Committee. (4) The management or School Level Fee Committce aggrieved by

the decision of the Divisional Fee Regulatory Committee in appeal

or reference may, within thirty days from the date of such decision, prefer an appeal. in Form-VI, before the Revision Committee

along with the proposal of fees submitted by management and the copy of the decision of the School Level Fee Committee and

Divisional Fee Regulatory Committee.

9. Sitting allowance to the non official members of the

Divisional Fee Regulatory Committee and _ Revision Committee.- Sitting allowance to representatives of private schools and representatives of parents nominated in the Divisional Fee Regulatory Committee and Revision Committee shall be paid

as decided by the State Government, from time to time.

10. Additional factors for determination of fee.- The

following factors shall be considered while deciding the fee in addition to the factors specified in section 8 of the Act, namely:-

(i) facilities made available by the school under e- governance i.e. hardware and software facilities;

(i1) strength of students;

(iii) other facilities made available to students such as swimming pool, horse riding, shooting, archery and performing art etc.;

183(16) W V an sin—Wm .c . -33.. .2011. Weft) shall be filled in by lottery. from amongst the applications received for that academic year under rule 5. 8. Procedure to refer proposal to Divisional Fee Regulatory Committee and to fil . appeal before Divisional F e Regulatory (‘ommittee and Revision Committee under section 6 of the Act.- (I) The Management of the school shall submit fee proposal to the School Level Fee Committee at least six months before the commencement ofihe next academic year in Form-Ill. (2) If the School Level Fee Committee fails to decide the fees within the period specified in sub-section (3) of section 6 of the Act. the management shall immediately refer the matter in Fortn- lV. along-with the proposal submitted to the School Level Fee Committee. to the Divisional Fee Regulatory Committee. within thirty days of expiry of the period specified in sub-section (3) of section 6 ofthe Act. for its decisron. (3) 'l‘he management may prefer an appeal in Form-V against the decision of the School Level Fee Committee within 30 days from the date of decision of the School Level Fee Committee. (4) The management or School Level Fee Committee aggrieved by the decision ofthe Divisional Fee Regulatory Committee in appeal or reference may. within thirty days from the date of such decision, prefer an appeal. in Form-VI. before the Revision Committee along with the proposal of fees submitted by management and the copy of the decision of the School Level Fee Committee and Divisional Fee Regulatory Committee. 9. Sitting allowance to the non official members of the Divisional Fee Regulatory Committee and Revision Committee.— Sitting allowance to representatives of private schools and representatives of parents nominated in the Divisional Fee Regulatory Committee and Revision Committee shall be paid as decided by the State Government, from time to time. 10. Additional factors for determination of fee.— The following factors shall be considered while deciding the fee in addition to the factors specified in section 8 0f the Act, namely:- (i) facilities made available by the school under e— governance i. 0. hardware and software facilities; (ii) strength of students; (iii) other facilities made available to students such as swimming pool, horse riding, shooting, archery and performing art etc.;

art-4 (71) WRIA WaT, WaT 14, 2017 183(17)

(iv) supply of books, notebooks, etc. and other educational

material provided to students; (v) provision of meal or snacks; and

(vi) any other factor submitted by the Management before

the School Level Fee Committee. 11. Maintenance of accounts and other records.- (1)

Every private school shall,- (a) maintain separate accounts for different kinds of

transactions, such as, fees collected, grants received,

financial assistance received, payments of salary to staff, purchase of machinery and equipment, laboratory apparatus and consumables, library books,

stationery, cotnputers, software and other expenditure

" incurred; (b) keep the registers, accounts and records within the

premises of their school as they shall be made available at all reasonable time for inspection; and

(c) preserve the accounts maintained, together with all vouchers relating to various items or receipts and expenditure, until the audit of accounts is over and

objections, if any, raised are settled. (2) Every private school shall, in addition to accounts and records specified in sub-rule (1), maintain the following, namely:-

(a) General Register; (b) Admission Register; (c) Fee Receipt;

(d) Fee Collection Register; ‘ (e) Cash Book;

(f) Library and Reading Room Account; (g) Staff Attendance Register and Staff Salary Resgister; (h) Students Atteridance Register; (i) Voucher File;

(j) Cheque Register; (k) Acquaintance Roll; (1) Stock Registers;

(m) Transfer Certificate Book;

(n) Examination Fees Collection Receipt; (0) Contingency Expenditure Register; (p) Asset Register; and

(q) BuildingRent Register.

rim-4 (11) W W451, watt 14. 2017 183117) (iv) supply of books, notebooks, etc. and other educational material provided to students; (v) provision of meal or snacks; and (vi) any other factor submitted by; the Management before the School Level Fee Committee. 11. Maintenance of accounts and other records.— (1) Every private school shall,- (a) maintain separate accounts for different kinds of transactions, such as, fees collected, grants received, financial assistance received, payments of salary to staff, purchase of machinery and equipment, laboratory apparatus and consumables, library books, stationery, computers, software and other expenditure ' incurred; (b) keep the registers, accounts and records within the premises of their school as they shall be made available at all reasonable time for inspection; and (c) preserve the accounts maintained, together with all vouchers relating to various items or receipts and expenditure, until the audit of accounts is over and objections, if any, raised are settled. (2) Every private school shall, in addition to accounts and records specified in sub—rule (I), maintain the following, namely:- (a) General Register; (b) Admission Register; (0) Fee Receipt; (d) Fee Collection Register; ‘ (e) Cash Book; . (1) Library and Reading Room Account; (g) Staff Attendance Register and Staff Salary Resgister; (h) Students Attendance Register; (i) Voucher File; . (j) Cheque Register; (k) Acquaintance Roll; (1) Stock Registers; (m) Transfer Certificate Book; (11) Examination Fees Collection Receipt; (o) Contingency Expenditure Register; (p) Asset Register; and (q) Buildinngent Register.

183(18) WRU Wola, PRAY 14, 2017 ara(71)

(3) Every private schoo! shall also maintain the other record of the

institution as per the orders issued by the Government, from time to time.

FORM-t

[See rule 3(2)} Noiice for the meeting of Parent-Teachers Association (Name of School)

No: Dated

Lo:

Mrs/MS..scccncsenadensesnass ciedewnenseesedna cteeeeses ee

Meinber of Parent-Teachers Association

Subject: Notice for the meeting of Parent-Teachers Association

Sir/Madam,

With reference to the subject cited above, as per the

provisions of the clause (e) of sub-section (2) of section 4 of ihe

Rajasthan Schools (Regulation of Fee) Act, 2016 (Act 14 of 2016) and rule 3(2) of the Rajasthan Schools (Regulation of Fee) Rules, 2017, the meeting of Parent-Teachers Association is scheduled on

the (Date) at : _—_———— (Time) at —_-—_—_(Place). Agenaa of the meeting is enclosed herewith. You are requested to attend the meeting in time.

Yours faithfully,

Secretary :

Parent-TeachersAssociatio

Name of School:

FORM-Ii [See rule 7(1)]

Notice for meeting of School Level Fee Committee -(Name of School)

No | Dated

To, Mrs/Ms

Metnber of the School Level Fee Committee

a n o m i e

a l a t a

ve r n

ve an am ee te

a t

185118) W WEI-4131. @3043: 2017 W400 (3) Every private school shall also maintain the other record of the institution as per the orders issued by the Government, from time to time. , F ()RM-l [See rule 3(2)] Notice for the meeting of Parent-'l‘eachers Association (Name of School) No: Dated To, Mrs/Ms ................................................ Member of Parent—Teachers Association Subject: Notice for the meeting of Parent-Teachers Association Sir/Madam, With reference to the subject cited above, as per the provisions of the clause (e) of sub—section (2) of section 4 of the Rajasthan Schools (Regulation of Fee) Act. 2016 (Act 14 of 2016) and rule 3(2) of the Rajasthan Schools (Regulation of Fee) Rules, 2017, the meeting of Parent-Teachers Association is scheduled on the (Date) at : m (Time) at ——~——(Place). Agenda of the meeting is enclosed herewith. You are requested to attend the meeting in time. Yours faithfully, Secretary - Parent-Teachers Associatio Name of School: FORM-II [See rule 7(1)] Notice for meeting of School Level Fee Committee . (Name of School) No ' ' Dated To, Mrs/Ms ................................................ Member of the School Level Fee Committee .a C)“,M«M=WM WW. i svwzwfiNnWa‘ My ’21

arr4 (1) YORIWs Ua, Ra 14, 2017 183(19)

Subject: Notice for the Meeting of School Level Fee

Committee.

Sir/Madam, .

With reference to the subject cited above, as per the

provisions of the section 4(2)(d) of the Rajasthan Schools

(Regulation of Fee) Act, 2016 (Act 14 of 2016) and rule 7(1)ofthe

Rajasthan Schools (Regulation of Fee) Rules, 2017, the meeting of

School Level Fee Committee of ————————— (Name of

School) is Scheduled on --—————{Date ) at hrs.) at ______-{ Place) to discuss the Pee proposal

of tie Management of the school and take an appropriate decision

thereupon.

Yours faithfully.

Secretary,

School Level Fee Committee.

Name of School:

FORM-III [See rule 8(1)]

Proposal of fee to be forwarded to the School Level Fee

Committee under section 6(2).

Tov

The School Level Fee Committee of

( Name of School) Subject: Proposal of fee structure for the academic

Vearo..ace. Sir/Madam, =

The management of ---—---- (Name of School) vide it’s resolution No. - dt. is pleased to

forward the fee structure for the academic year as detailed below:—

1. Name of Trust or Society:

2. NameofSchool: 3. UDISE No. :

4. Name of Board (RBSE or CBSE cr Other) :

5. Medium: 6. Standard trom to

ma S e e < a

as ee

em na

nc ac

an en

im is

aa

m4 (wt)w W eta—Ta, m 14, 2017 . _ 183(19) Subject: Notice for the Meeting or” School Level Fee Committee. , Sir/Madam, . With reference to the subject cited above, as per the provisions of the section 4(2)(d) of the Rajasthan Schools (Regulation of Fee) Act. 2016 (Act 14 of 2016) and rule 7(1) of the Rajasthan Schools (Regulation of Fee) Rules, 2017, the meeting of School Level Fee Committee of ~————-———4 (Name of School) is Scheduled on -~————4(Date ) at _ hrs.) at ——~—-( Place) to discuss the Fee proposal ol‘ the Management of the school and take an appropriate decision thereupon. Yours faithfully~ Secretary School Level lee Committee. Name of School: FORM—III [See rule 8(1)] Proposal of fee to be forwarded to the School Level Fee Committee under section 6(2). To. The School Level Fee Committee of ( Name of School) Subject: Proposal of fee structure for the academic year......... Sir/Madam, _ a The management of —.—-———* (Name of School) vide it’s resolution No. ' dt. is pleased to forward the fee structure for the academic year as detailed below:— . Name of Trust or Society: . Name of School: . U DISE No. : . Name of Board (RBSE or CBSE or Other) : . Medium: 6. Standard from to LII-QDJNH

183(20) WRIA Walaa, HKael 14, 2017 FnT4(71)

7. Number of Divisions/Sections:

8. Number of Students:

9. Class-wise proposed fee:

R E E T

peer nm en eR Rt

G e m e m e e

Sr. No. Class Last Proposed Difference Percentage of Remark Year’s Fee =‘ Fee (4-3) fee hike

(> @) (3) (4) 5) (5) (7)

Note: Itemwise fee details Yours faithfully, Secretary. Name of School:

Name of Trust or Society:

Date: ——

Principal / Head Master Name of School:

On behalf of

Name of Trust or Society: ————_—_____—

FORM- IV . [See rule &(2)]}

Reference to the Divisional Fee Regulatory Committee for its decision under section 6(4).

From: Name of School: Address : Date:

To,

Ex-Officio Member Secretary, Divisional Fee Regulatory Committee, ——________—— Division.

Sub. : Reference of Fee Structure under_rule8(2) of the Rajasthan Schools .

(Regulation of Fee) Rules, 2017. Sir/Madam,

‘The management of ———__——(Name of School) vide it’s resolution No.

153(20) W W—W‘SL waft 14, 2017 minor) 7. Number of Divisions/Sections: 8. Number of Students: 9. Class-wise proposed fee: g tera‘vf!Wa'£""C‘?H‘Wfim Sr. No. Ciass Last Proposed Difference Percentage of Remark Year‘s Fee Fee (4-3) fee hike (l) (2) (3) (4) (5) (5) (7) Note: Itemwise fee details Yours faithfully, Secretary. Name of School: Name of Trust or Society: Date: ‘ Principal / Head Master Name of School: On behalf of Name of Trust or Society: '—-————-—— —— FORM- IV [See rule 8(2)] Reference to the Divisional Fee Regulatory Committee for its decision under section 6(4). From: Name of School: Address : Date : To, Ex-Officio Member Secretary, Divisional Fee Regulatory Committee, ——~—-——————-—-— Division. Sub. : Reference of Fee Structure under ru168(2) of the Raiasthan Schools . , (Regulation of Fee) Rules, 2017. Sir/Madam, 'The management of ———(Namt: ’of School) vide it’s“ resolution No.

art 4 (7) WaT Wa-TF, Hal 14, 2017 183(21)

dated. —-—— has taken a decision to revise the fee structure for the academic year --—---— as detailed below:- The proposal to revise the fee structure was presented to the School Level Fee Committee of our---—————-——- (Name of

School) dt. —---———— as per the provisions of rule 8(1). Since

the Schcol Level Fee Commiitee has not communicated it’s approval or remarks on the proposal, the managementof-——-—_-

(Name of School) hereby submits to issue appropriate decision in respect of fee structure. The details of the proposed fee-structure and justification for the same are accompanied with relevant documents.

. Name of the Trust or Society:

. Name of the School :

. UDISE No. :

. Board Type (RBSE or CBSE or Others):

. Medium of instruction :

. Standards from to

. Number of Divisions/Sections :

. Number of Students :

. Class-wise fee structure:

WO e I A O

B & W

Sr.No. Class Last . Proposed Difference Percentageof Remark

Year's Fee Fee (4-3) Fee hike

(1) (2) @G) (4) (5) (9) (7)

Yours faithfully, Secretary. —

‘Name of School:

Name of Trust or Society : Date : Principal or Head Master

Name of School: ———_——__—— On behalf of Name of Trust or Society:*

Copy to School Level Fee Committee

WI 4 (1T) WIT? VENT—W, m 14i 2017 183(21) dated. mm has taken a decision to revise the fee structure forthe academic year ————-—— as detailed below: The proposal to revise the fee structure was presented to the School Level Fee Committee of our————————- (Name of School) dt. ~—————————~ as per the provisions of rule 8(1). Since the School Level Fee Committee has not communicated it‘s approval or remarks on the proposal. the management_of—————~ (Name of School) hereby submits to issue appropriate~ decision in respect of fee structure. The details of the proposed fee-structure and justification for the same are accompanied with relevant documents. . Name of the Trust or Society : . Name of the School : . UDISE No. : . Board Type (RBSE or CBSE or Others) : . Medium of instruction : ‘ . Standards from to . Number of Divisions/Sections : . Number of Students : . Class-wise fee structure: \OOOHONUI-filevr—i Sr.No. Class Last - Proposed Difference Percentage of Remark Year’s Fee Fee (46) Fee hike (l) (2,) (3) t4) t5) (6) (7) Yours faithfully, Secretary. 4 Name of School: Name of Trust or Society : Date : Principal or Head Master Name of School: ——~——— ——— On behalf of Name of Trust or Societyz' Copy to School Level Fee Committee

193222) Rae eT, RAR 14, 2017 TACT)

FORM-V [See rule 8(3)]

Appeal to the Divisional Fee Regulatory Committee

From:

Name of School: Address:

Date: —- To. .

Ex-Officio Member-Secretary,

Divisional Fee Regulaiory Committee, —________—— Division.

Subject: Appeal on the Revision of Fee Structure under

rule 8(3) of the Rajasthan Schools (Regulation of

Fee) Rules, 2017.

Sir/Madam,

The management of - ( Name of School) vide it’s

resoluiion No. dt. has taken a decision

- to revise the fee structure for the academic year ——————————

as detailed below:-

Since there is a difference in the fee structure proposed by the

management and the fee structure approved by the School Level

Fee Committee, the management of School Name —-———— has

made an.appeal for appropriate decision. The details of the

proposed fee structure and justification for the same is detailed in

the accompanying documents.

. Name of the Trust or Society :

. Name of the School:

. UDISE No.:

. Name of the Board (RBSE or CBSE or Others) :.

. Medium of instruction :

. Standards from to

. Number of Divisions/Sections:

. Number of students:

. Class-wise fee structure:

W A I N A D N H W N

Sr.No. Class Last Proposed Difference Percentage of Remark

Wears Fees ree (4-3) Fee hike

() (2) (3) (4) (5) (6) (7)

1§§§22lsswsYWEWW-UZW 15:29.17 “M.“fiWAtW) FORM-V [See rule 8(3)] Appeal to the Divisional Fee Regulatory Committee From: Name of School: Address: ‘ Date: —--—v——————-w« To, v Ex-Ot‘ficio Member-Secretary, Divisional Fee Regulatory Committee. ,._.._._____. Division. Subject: Appeal on the Revision of Fee Structure under rule 8(3) of the Rajasthan Schools (Regulation of Fee) Rules 2017. Sir/Madam, The management of — ( Name ol~ School) View its resolution No. dt. has taken a decision » to revise the fee structure for the academic year M— as detailed below:- Since there is a difference in the fee structure preposed by the management and the fee structure approved by the School LeVel Fee Committee, the management of School Name ——-———-— has made an .appeal for appropriate decision. he details of the proposed fee structure and justification for the same is detailed in the accompanying documents. . Name of the Trust or Society : . Name of the School : . UDISE N0. : . Name of the Board (RBSE or CBSE or Others) : . . Medium of instruction : . Standards from to . Number of Divisions/Sections: . Number of students: . Class—wise fee structure: \OOOQONM-blevr-d Sr.No. Class Last Proposed Difference Percentage of Remark Year’s Fee Fee (4-3) Fee hike (l) (2) (5) (4) (5) (6) (7)

amt 4(T) ASTRA WG-0, Ral 14, 2017: 183(23)

Yours faithfully,

Secretary Name of School: : Name of Trust or Society : ——--——--—_—_—_-

Date : on ee en

Principal / Head Master Name of School: - ——

On behalf of (Name of the Trust or Society) : ——

FORM-VI [See rule 8(4)]

Appeal to Revision Committee under section 6(7)of the Act

From : Name of School: -—__--__-_ Address: -—-—------—-

EU esoe

To.

Ex- Officio Member-Secretary,

Revision Committee,

Sub: Appeal under section 6 (7) of the Rajasthan Schools (Regulation of Fee) Act 2016 and ruie 8 (4) of the Rajasthan Schools (Regulation of Fee) Rules, 2017.

Sir/Madam,

The Management/School Level Fee Committee of —————-——— —-(Name of School) aggrieved by the decision of Divisional Fee Regulatory Committee No. dt. ---

hereby submits its appeal as detailed in the accompanying

statements and supported by the documentary evidence, for the consideration of the Revision Committee :

. Name of the Trust or Society:

. Name of the School:

. UDISE No. :

. Name of the Board (RBSE or CBSE or Others):

. Medium of instruction:

. Standards from to

. Number of Divisions/Sections:

. Number of students:

P S A I N D N H W N

3m {(#1) y W m—tta, 3»?ij 14,2017 . 183(23) Yours faithfully: Secretary Name of School: ‘ - Name ot~ Trust or Society : ————-—--—~-————~—~ Date : ~ ~—~ «- —r—-< Principal / llead Master Name ot‘Seliool: — ——f—————— On behalf of('Name of the Trust or Society) : ——- ‘ F ORM—Vl [See rule 8(4)] Appeal to Revision Committee under section 6( 7)0f the Act From : Name of School: «mm—w- Address: » —---—» —-——~«-—— Date: W~~ MAM-m- lo. Ex— ()t‘ticio Member—Secretary, Revision Committee. Sub: Appeal under section 6 (7) of the Rajasthan Schools (Regulation of Fee) Act 2016 and rule 8 (4) of the Rajasthan Schools (Regulation of Fee) Rules. 2017. Sir/Madam, The Management/School Level Fee Committee of é————- v—(Name of School) aggrieved by the decision of Divisional Fee Regulatory Committee No. (it. hereby submits \its appeal as detailed in the accompanying statements and supported by the documentary evidence, for the consideration of the Revision Committee : . Name of the Trust or Society: . Name of the School: . UDISE No. : . Name ofthe Board (RBSE or CBSE or Others): . Medium of instruction: . Standards from to . Number of Divisions/Sections: . Number of students: WNOMAinxJ-d

183(24) WER WATS, WAT 14, 2017 arT4(7)

9. Class-wise fee structure:

Sr.No. Class Last Proposed Difference Percentage of Remark

Year’s Fee Fee (4-3) Fee hike

(1) (2) (G3) (4) (5) (6) (7)

Yours faithfully,

Secretary.

Nameof Schooi: - Name of Trust or Society :

Date : Principal / Head Master Name of School:

On behalf of (Name of the Trust or Society) : —----—-—------—

[No. F.8(17) Edu.-5/Fee/2004 Part] By the Order of the Governor,

Nareshpal Gangwar,

Secretary to the Government.

Government Central Press, Jaipur.

°

1.83124) W m-rta, waft 14, 2017 21117401) 9. Class-wise fee structure: Sr.No. Class Last Proposed DitTerence Percentage of Remark Year’s Fee Fee (43) Fee hike (I) (2) (3) (4) (5) (6) (7) Yours faithfully, Secretary. Name ofSchool: * Name of Trust or Society : Date : Principal / Head Master Name of School: On behalf of (Name of the Trust or Society) : ———»— —————--—--———- [No. F.8(17) Edu.—5/Fee/2004 Part] By the Order of the Governor, Nareshpal Gangwar, Secretary to the Government. Government Central Press, Jaipur. o

SECTIONS